(data stored in ACNUC10043 zone)

EMBL: AP011532.PHOU-1

AP011532.PHOU-1      Location/Qualifiers
FT   CDS             complement(672894..673571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU-1"
FT                   /locus_tag="MCP_0695"
FT                   /product="phosphate transport system protein PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0695"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60767"
FT                   /db_xref="GOA:D1YWE5"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWE5"
FT                   /protein_id="BAI60767.1"
FT                   /translation="MATVVSSRVDGIKADVLLMMGYVGLSIDEAVRSLDDRDVDTAKCV
FT                   IGRDRQINEYLRRIEAECLDMLAKKLEGEELRTVAASYKLVSDVERIGDYCTAIANVTL
FT                   AVANKPVTTTALDIIKMGRTALQMLNICMEAYKGRSEVNVEEVFDLDKSIDNLYNDSFV
FT                   GSITSILREPNTITNVIYLTMASRALERIGDHLTDIAERIIFIRSGKIVERSEPMHVPE
FT                   FPE"
     MATVVSSRVD GIKADVLLMM GYVGLSIDEA VRSLDDRDVD TAKCVIGRDR QINEYLRRIE        60
     AECLDMLAKK LEGEELRTVA ASYKLVSDVE RIGDYCTAIA NVTLAVANKP VTTTALDIIK       120
     MGRTALQMLN ICMEAYKGRS EVNVEEVFDL DKSIDNLYND SFVGSITSIL REPNTITNVI       180
     YLTMASRALE RIGDHLTDIA ERIIFIRSGK IVERSEPMHV PEFPE                       225
//

If you have problems or comments...

PBIL Back to PBIL home page