(data stored in ACNUC10043 zone)

EMBL: AP011532.PYCB

AP011532.PYCB        Location/Qualifiers
FT   CDS             175963..177705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pycB"
FT                   /locus_tag="MCP_0183"
FT                   /product="pyruvate carboxylase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0183"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60255"
FT                   /db_xref="GOA:D1YUY3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUY3"
FT                   /protein_id="BAI60255.1"
FT                   /translation="MVRITETILRDAHQSLAATRMRTADMVPIIEKLDQVGFYSLEAWG
FT                   GATFDTCIRYLNEDPWERLRIIKKAAKTTPIQMLLRGQNLVGYRHYSDDVVEKFVTLAS
FT                   KNGVDIFRVFDAVNDIRNMEASIKAARKCGARVQGTICYTLSPVHSNDKFVEMAKELAA
FT                   LDCDSICIKDMAGLIMPEPAADLVSRLKKEVGLPVDLHCHCTNGIAPMSYYAAAGSGVD
FT                   ILDTAMSPFGFGTSQPATESIVGALQGTPYDTGLDLKLLAEIAEYFWKVKEKYGAIIDP
FT                   ILERIDVNVLVYQIPGGMLSNLVSQLKQQNKMELYDAVLKEVPVVRRELGYPPLVTPTS
FT                   QIVGTQAVLNVVMGERYKVVPKEVKDYVKGFYGRSPAPVDPEIQKKVIGDEQPITVRPA
FT                   DLLKPEMPGVIAAVNGLGLKNVKDEDYITYALYPPVAEKFLKGEIKPEALEPKAAPAKK
FT                   SKLGPSARRFLIEMDGQVKEIRIEALDAPLPPIGVAVTAQPQAEAVVEEASSNGAVTSP
FT                   MQGTILKVNVKVGDSVKKGDVIAVLEAMKMENDIVAHSSGTVKAVYAQKGKNVDANAVL
FT                   AVIE"
     MVRITETILR DAHQSLAATR MRTADMVPII EKLDQVGFYS LEAWGGATFD TCIRYLNEDP        60
     WERLRIIKKA AKTTPIQMLL RGQNLVGYRH YSDDVVEKFV TLASKNGVDI FRVFDAVNDI       120
     RNMEASIKAA RKCGARVQGT ICYTLSPVHS NDKFVEMAKE LAALDCDSIC IKDMAGLIMP       180
     EPAADLVSRL KKEVGLPVDL HCHCTNGIAP MSYYAAAGSG VDILDTAMSP FGFGTSQPAT       240
     ESIVGALQGT PYDTGLDLKL LAEIAEYFWK VKEKYGAIID PILERIDVNV LVYQIPGGML       300
     SNLVSQLKQQ NKMELYDAVL KEVPVVRREL GYPPLVTPTS QIVGTQAVLN VVMGERYKVV       360
     PKEVKDYVKG FYGRSPAPVD PEIQKKVIGD EQPITVRPAD LLKPEMPGVI AAVNGLGLKN       420
     VKDEDYITYA LYPPVAEKFL KGEIKPEALE PKAAPAKKSK LGPSARRFLI EMDGQVKEIR       480
     IEALDAPLPP IGVAVTAQPQ AEAVVEEASS NGAVTSPMQG TILKVNVKVG DSVKKGDVIA       540
     VLEAMKMEND IVAHSSGTVK AVYAQKGKNV DANAVLAVIE                             580
//

If you have problems or comments...

PBIL Back to PBIL home page