(data stored in ACNUC10043 zone)

EMBL: AP011532.RNP4

AP011532.RNP4        Location/Qualifiers
FT   CDS             complement(305964..306284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnp4"
FT                   /locus_tag="MCP_0304"
FT                   /product="ribonuclease P protein component 4"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0304"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60376"
FT                   /db_xref="GOA:D1YVA4"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="InterPro:IPR016432"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVA4"
FT                   /protein_id="BAI60376.1"
FT                   /translation="MPERRRKEPQRKPFNVDMAEQRIKRLFELAEQAYPGRPDLADRYA
FT                   DIARRISMRHRVGIPRELKRRVCKGCGSFLVPGDNCRVRLDGNNIVITCMKCGAIKRYP
FT                   YR"
     MPERRRKEPQ RKPFNVDMAE QRIKRLFELA EQAYPGRPDL ADRYADIARR ISMRHRVGIP        60
     RELKRRVCKG CGSFLVPGDN CRVRLDGNNI VITCMKCGAI KRYPYR                      106
//

If you have problems or comments...

PBIL Back to PBIL home page