(data stored in ACNUC10043 zone)

EMBL: AP011532.RPL10E

AP011532.RPL10E      Location/Qualifiers
FT   CDS             375020..375538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl10e"
FT                   /locus_tag="MCP_0368"
FT                   /product="50S ribosomal protein L10e"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0368"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60440"
FT                   /db_xref="GOA:D1YVG8"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR018255"
FT                   /db_xref="InterPro:IPR022981"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVG8"
FT                   /protein_id="BAI60440.1"
FT                   /translation="MARKPGRMYKNFSGPAYTRRKYMGGVPGVKVTQFDMGNLTDELPI
FT                   AVTLVVNETCQIRHDALEAARISANRYLMSDVGKQDYRFKVRVYPHQVLRENKQATGAG
FT                   ADRVSDGMRRAFGKAIGTAARVYSGQGIFTIYTNRPNFEKAKEALRRAGHKLPSPHRLV
FT                   VEKGAELVK"
     MARKPGRMYK NFSGPAYTRR KYMGGVPGVK VTQFDMGNLT DELPIAVTLV VNETCQIRHD        60
     ALEAARISAN RYLMSDVGKQ DYRFKVRVYP HQVLRENKQA TGAGADRVSD GMRRAFGKAI       120
     GTAARVYSGQ GIFTIYTNRP NFEKAKEALR RAGHKLPSPH RLVVEKGAEL VK               172
//

If you have problems or comments...

PBIL Back to PBIL home page