(data stored in ACNUC10043 zone)

EMBL: AP011532.RPS17E

AP011532.RPS17E      Location/Qualifiers
FT   CDS             complement(224966..225163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps17e"
FT                   /locus_tag="MCP_0227"
FT                   /product="30S ribosomal protein S17e"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60299"
FT                   /db_xref="GOA:D1YV27"
FT                   /db_xref="InterPro:IPR001210"
FT                   /db_xref="InterPro:IPR018273"
FT                   /db_xref="InterPro:IPR036401"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV27"
FT                   /protein_id="BAI60299.1"
FT                   /translation="MGSIKQTNIKSTGHALLRQHPDEFTTDFNANKAQVEKLTGVDSKT
FT                   LRNRVAGYVTRKVSSKGRRK"
     MGSIKQTNIK STGHALLRQH PDEFTTDFNA NKAQVEKLTG VDSKTLRNRV AGYVTRKVSS        60
     KGRRK                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page