(data stored in ACNUC10043 zone)

EMBL: AP011532.TBP-1

AP011532.TBP-1       Location/Qualifiers
FT   CDS             complement(125232..125798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbp-1"
FT                   /locus_tag="MCP_0130"
FT                   /product="TATA-box-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60202"
FT                   /db_xref="GOA:D1YUT0"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR030491"
FT                   /db_xref="InterPro:IPR033711"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUT0"
FT                   /protein_id="BAI60202.1"
FT                   /translation="MSKAEEAKKTITIENVVASTAIGQEIDLKSVTLALEGADYDPEQF
FT                   PGLVYRTKDPKTAALIFRSGKIVCTGAKSIEDVDRGLKKVFKKMDSVGIKVDQNPEITV
FT                   QNIVASADLGSVLNLNAIAIGLGLENIEYEPEQFPGLVYRLDHPKVVVLLFGSGKLVVT
FT                   GGKKPKDAEEAVDRIVKELEGLALL"
     MSKAEEAKKT ITIENVVAST AIGQEIDLKS VTLALEGADY DPEQFPGLVY RTKDPKTAAL        60
     IFRSGKIVCT GAKSIEDVDR GLKKVFKKMD SVGIKVDQNP EITVQNIVAS ADLGSVLNLN       120
     AIAIGLGLEN IEYEPEQFPG LVYRLDHPKV VVLLFGSGKL VVTGGKKPKD AEEAVDRIVK       180
     ELEGLALL                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page