(data stored in ACNUC10043 zone)

EMBL: AP011532.TOP6A-1

AP011532.TOP6A-1     Location/Qualifiers
FT   CDS             complement(29386..30519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="top6A-1"
FT                   /locus_tag="MCP_0040"
FT                   /product="type II DNA topoisomerase VI subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60112"
FT                   /db_xref="GOA:D1YUJ0"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ0"
FT                   /protein_id="BAI60112.1"
FT                   /translation="MALARDILRDRRLTRDQEQAIMILSAYCLGSMVRVENALPYTFKA
FT                   LKVDRSSVEYDDVDGYNVTGDTVAMSTANIDQAATIAKLQFLVNHVIETVAANSVSTKR
FT                   DCYYMLKNQFQKYPWMDLSGQGESDRLIDTLERIIRMQRENLNIIADPKGLIYGDITLV
FT                   DEEGKEFNCHEREQGITGLAGQWEVKSHHVKAVIAIEKTGVFMDLKKLKVADELGIGLI
FT                   HLGGQPARGCRALINLLSEKGIPIGVLTDLSPWSGMIAKSVLSGSIAAAHLSGLHASKA
FT                   AFLGIESSDVDDWLKDVWKSVQEPLSGHDTARAQNNLSLPYMQDDYWKGENSWFVKSGK
FT                   KTELEALGTAAGSPLKRKEFYKKYLRAKLKEKLKVKV"
     MALARDILRD RRLTRDQEQA IMILSAYCLG SMVRVENALP YTFKALKVDR SSVEYDDVDG        60
     YNVTGDTVAM STANIDQAAT IAKLQFLVNH VIETVAANSV STKRDCYYML KNQFQKYPWM       120
     DLSGQGESDR LIDTLERIIR MQRENLNIIA DPKGLIYGDI TLVDEEGKEF NCHEREQGIT       180
     GLAGQWEVKS HHVKAVIAIE KTGVFMDLKK LKVADELGIG LIHLGGQPAR GCRALINLLS       240
     EKGIPIGVLT DLSPWSGMIA KSVLSGSIAA AHLSGLHASK AAFLGIESSD VDDWLKDVWK       300
     SVQEPLSGHD TARAQNNLSL PYMQDDYWKG ENSWFVKSGK KTELEALGTA AGSPLKRKEF       360
     YKKYLRAKLK EKLKVKV                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page