(data stored in ACNUC10043 zone)

EMBL: AP011532.TOP6B-1

AP011532.TOP6B-1     Location/Qualifiers
FT   CDS             complement(30703..32346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="top6B-1"
FT                   /locus_tag="MCP_0041"
FT                   /product="type II DNA topoisomerase VI subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0041"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60113"
FT                   /db_xref="GOA:D1YUJ1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005734"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015320"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ1"
FT                   /protein_id="BAI60113.1"
FT                   /translation="MADRKTARELAKDMKEISFSEFIATNPHLVGFESSLKMIPMSIHE
FT                   ILTNSLDACESAGILPEVWIDLKSIDEKGRLKRYRLTVRDNGPGIMPKNIPPVFGKLLY
FT                   GSKFGVRKQSRGQQGIGVSAVVLISQIKTGEHAVVRSSTDGRNTHVYELTVDVNKNAAK
FT                   IHNACKEKSDGWRGVEVSVVLEAMFSSRIMEYLELTAAINPHMALHYDGVDEKDRLDVE
FT                   RRTDVLPRQPVETKPHPLGADYDLLSKMAARTKHRRLYDFLKGEFDRMRPDIVRNIVRS
FT                   CKDTVDVDRPPAELSRKELSGLVEAMRGVETLPPSPECLSPVGEDILIKGVVDRLRPKF
FT                   IAAVTRKPSAMRGQPFLVEIIMAYGCEADFGGSPDPITGVSVHRFVNRVPLLFSESSDV
FT                   ILKAVREAGLGRYEVVPESRSHVFVHVAGVNIPYTSESKEAVKAVDEYYEEIRLAVQDC
FT                   GRKISKHIRQVKRTEENLIKGKKKAVIHSLLLRELNRFAGKKLADLAYAESFGFDDSLA
FT                   EVVSQYHLDVWRTAPRKMKREEAKGAAVAA"
     MADRKTAREL AKDMKEISFS EFIATNPHLV GFESSLKMIP MSIHEILTNS LDACESAGIL        60
     PEVWIDLKSI DEKGRLKRYR LTVRDNGPGI MPKNIPPVFG KLLYGSKFGV RKQSRGQQGI       120
     GVSAVVLISQ IKTGEHAVVR SSTDGRNTHV YELTVDVNKN AAKIHNACKE KSDGWRGVEV       180
     SVVLEAMFSS RIMEYLELTA AINPHMALHY DGVDEKDRLD VERRTDVLPR QPVETKPHPL       240
     GADYDLLSKM AARTKHRRLY DFLKGEFDRM RPDIVRNIVR SCKDTVDVDR PPAELSRKEL       300
     SGLVEAMRGV ETLPPSPECL SPVGEDILIK GVVDRLRPKF IAAVTRKPSA MRGQPFLVEI       360
     IMAYGCEADF GGSPDPITGV SVHRFVNRVP LLFSESSDVI LKAVREAGLG RYEVVPESRS       420
     HVFVHVAGVN IPYTSESKEA VKAVDEYYEE IRLAVQDCGR KISKHIRQVK RTEENLIKGK       480
     KKAVIHSLLL RELNRFAGKK LADLAYAESF GFDDSLAEVV SQYHLDVWRT APRKMKREEA       540
     KGAAVAA                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page