(data stored in ACNUC10043 zone)

EMBL: AP011532.VHTD

AP011532.VHTD        Location/Qualifiers
FT   CDS             complement(379845..380303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vhtD"
FT                   /locus_tag="MCP_0374"
FT                   /product="putative F420-nonreducing hydrogenase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0374"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60446"
FT                   /db_xref="GOA:D1YVH4"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVH4"
FT                   /protein_id="BAI60446.1"
FT                   /translation="MTKKIVVLGCGNTLMGDDGVGIRVIERLQGMKLPENVEVIEAGVG
FT                   GMSILSWIEGADKAVIVDAVQTGNEPPGTVYEFTDKELPPSDMFMLSLHDLNLVDTINV
FT                   GRVVQKMPEDIVIIGVEVKRVAEFTKELTPEVEGAIPEVLDLVLKELK"
     MTKKIVVLGC GNTLMGDDGV GIRVIERLQG MKLPENVEVI EAGVGGMSIL SWIEGADKAV        60
     IVDAVQTGNE PPGTVYEFTD KELPPSDMFM LSLHDLNLVD TINVGRVVQK MPEDIVIIGV       120
     EVKRVAEFTK ELTPEVEGAI PEVLDLVLKE LK                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page