(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE10

ASFUM1_4.PE10        Location/Qualifiers
FT   CDS             join(54334..54582,54639..55733)
FT                   /codon_start=1
FT                   /gene_family="HOG000216789" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905462"
FT                   /orf_name="AFUA_4G00200"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL84398.1"
FT                   /db_xref="HOGENOM:HBG054309"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI00005200A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W943"
FT                   /transl_table=1
FT                   /translation="MASIIVLPTELLARIISFLDRSSLKAIRQTSRRLSQIATPQLFAT
FT                   LRLFPDEKSYEAVDRITDHATLKKMVKKVYVNTCEDDYDDYDEEEVELTKDFKDRITKF
FT                   RDFPNVQSAVLRFDKHCCTGHELWMTERPETIAFRTETLRVFFQWLASFETPLRELGIR
FT                   NMQDVNVGDENISANIEKLLQNLCTLRLSIVTEHNDGAPEYDVEFPELHDFFAQIPSVW
FT                   LKPSASSLEHLTLSCDNYFGFYPQLELSEVHFPHLKSLAFGNYCFVRDSQLEWILSHAA
FT                   TLTNLSFDDCAILYDVCLAEEHLNWGPFLKSEMEIRRELDDRVRKKYYRSYDKRWHDYF
FT                   DSFRTKLPHLRQFLIGSNDWGDGVPFEKEAEVRICLRESRYMACYDGYGPSPYMENHHY
FT                   RLPEWERAPPKCDDEDRDSLRLLFEKTGQRVVKIPFLTHGYMSADEEF"
     MASIIVLPTE LLARIISFLD RSSLKAIRQT SRRLSQIATP QLFATLRLFP DEKSYEAVDR        60
     ITDHATLKKM VKKVYVNTCE DDYDDYDEEE VELTKDFKDR ITKFRDFPNV QSAVLRFDKH       120
     CCTGHELWMT ERPETIAFRT ETLRVFFQWL ASFETPLREL GIRNMQDVNV GDENISANIE       180
     KLLQNLCTLR LSIVTEHNDG APEYDVEFPE LHDFFAQIPS VWLKPSASSL EHLTLSCDNY       240
     FGFYPQLELS EVHFPHLKSL AFGNYCFVRD SQLEWILSHA ATLTNLSFDD CAILYDVCLA       300
     EEHLNWGPFL KSEMEIRREL DDRVRKKYYR SYDKRWHDYF DSFRTKLPHL RQFLIGSNDW       360
     GDGVPFEKEA EVRICLRESR YMACYDGYGP SPYMENHHYR LPEWERAPPK CDDEDRDSLR       420
     LLFEKTGQRV VKIPFLTHGY MSADEEF                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page