(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE100

ASFUM1_4.PE100       Location/Qualifiers
FT   CDS             complement(302121..302735)
FT                   /codon_start=1
FT                   /gene_family="HOG000216752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210309"
FT                   /orf_name="AFUA_4G01120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27172.1"
FT                   /db_xref="HOGENOM:HBG324516"
FT                   /db_xref="UniParc:UPI0000F51BB1"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA89"
FT                   /transl_table=1
FT                   /translation="MRASFLLPVAIYVLTAYADDKTTTVGYFIPSWSVTLLSYGVWTST
FT                   GASVAGINAAATTYHLGCLKDAPKTDCNIKNSWTIIQGPETVSATGVYTASTSGKETSY
FT                   DITVTESYECKIRSRTESASCTMSVGMTGSVGGAAITSSTSTSATYSPATSSYYELVVT
FT                   AGVDKFTVPEATKTPGVAAAGPAGALITAGPVVAAAVAALL"
     MRASFLLPVA IYVLTAYADD KTTTVGYFIP SWSVTLLSYG VWTSTGASVA GINAAATTYH        60
     LGCLKDAPKT DCNIKNSWTI IQGPETVSAT GVYTASTSGK ETSYDITVTE SYECKIRSRT       120
     ESASCTMSVG MTGSVGGAAI TSSTSTSATY SPATSSYYEL VVTAGVDKFT VPEATKTPGV       180
     AAAGPAGALI TAGPVVAAAV AALL                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page