(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE101

ASFUM1_4.PE101       Location/Qualifiers
FT   CDS             join(305348..305704,305775..305904,305965..306179)
FT                   /codon_start=1
FT                   /gene_family="HOG000216630" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274674"
FT                   /orf_name="AFUA_4G01130"
FT                   /product="Dienelactone hydrolase family protein "
FT                   /EC_number="3.1.1.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL84306.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG054601"
FT                   /db_xref="HOGENOM:HBG324508"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="UniParc:UPI000051EB27"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9D5"
FT                   /transl_table=1
FT                   /translation="MYTKYYEFSSPSLVETYFSYPEDRSTTHGVLILTDVIGHRFINSQ
FT                   LIADQFAANGYIVAMPDLFHGDSVKLNRPETFNLMSWLEGHPIERVDPVVDSVLKYMRT
FT                   RLGCEKIGAVGYCFGAKYVVRFLRPEEGKVDVGYIAHPGFVELDELSAITGPLSIAAAE
FT                   TDDVFPTSKRHQSEGILRDSGLPYQINLYGRVEHGFAIRADLTDKAKKFAKEQAFLQAV
FT                   QWFDEFVKGQN"
     MYTKYYEFSS PSLVETYFSY PEDRSTTHGV LILTDVIGHR FINSQLIADQ FAANGYIVAM        60
     PDLFHGDSVK LNRPETFNLM SWLEGHPIER VDPVVDSVLK YMRTRLGCEK IGAVGYCFGA       120
     KYVVRFLRPE EGKVDVGYIA HPGFVELDEL SAITGPLSIA AAETDDVFPT SKRHQSEGIL       180
     RDSGLPYQIN LYGRVEHGFA IRADLTDKAK KFAKEQAFLQ AVQWFDEFVK GQN              233
//

If you have problems or comments...

PBIL Back to PBIL home page