(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE108

ASFUM1_4.PE108       Location/Qualifiers
FT   CDS             join(322040..322436,322483..322961)
FT                   /codon_start=1
FT                   /gene_family="HOG000216747" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210310"
FT                   /orf_name="AFUA_4G01210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84299.2"
FT                   /db_xref="HOGENOM:HBG054525"
FT                   /db_xref="InterPro:IPR022085"
FT                   /db_xref="UniParc:UPI0000F51C49"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9E2"
FT                   /transl_table=1
FT                   /translation="MGKDNFIRQVENSAEFKLLDKVVKDQVTVQDAVQEVIDMTMTALS
FT                   VHGPSKQGGIGVPDYNISLAVMELAQRREPAEHTKLAKFVSHLQKQIAIDPSTNEPLTV
FT                   QRDILWTDMPSFGYTELETWSEFGGDYKDPCDITLASEQRDRWTKLNAFLAQLTQAADI
FT                   HYPPPGEEVRFFPLDKSLRAIWVMAMAFENERPPSSLGDTAAMEAACLWFIYAAKRLWA
FT                   NVVNNRTYPAVAGAGPGKRYEAAGWTGYTRERWGIWEDALKEARAACKIERMRVLINNA
FT                   LASMRDAVNQ"
     MGKDNFIRQV ENSAEFKLLD KVVKDQVTVQ DAVQEVIDMT MTALSVHGPS KQGGIGVPDY        60
     NISLAVMELA QRREPAEHTK LAKFVSHLQK QIAIDPSTNE PLTVQRDILW TDMPSFGYTE       120
     LETWSEFGGD YKDPCDITLA SEQRDRWTKL NAFLAQLTQA ADIHYPPPGE EVRFFPLDKS       180
     LRAIWVMAMA FENERPPSSL GDTAAMEAAC LWFIYAAKRL WANVVNNRTY PAVAGAGPGK       240
     RYEAAGWTGY TRERWGIWED ALKEARAACK IERMRVLINN ALASMRDAVN Q                291
//

If you have problems or comments...

PBIL Back to PBIL home page