(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE109

ASFUM1_4.PE109       Location/Qualifiers
FT   CDS             join(complement(325710..325877),complement(325407..325654),
FT                   complement(325259..325358))
FT                   /codon_start=1
FT                   /gene_family="HOG000199989" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274678"
FT                   /orf_name="AFUA_4G01220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84298.2"
FT                   /db_xref="HOGENOM:HBG054514"
FT                   /db_xref="UniParc:UPI0000F51C4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9E3"
FT                   /transl_table=1
FT                   /translation="MSPTSVSDSHPAVLSLRTAALVTSAAGFISLAWSITHHKDISDDG
FT                   AGGINSIVLGTIAYAFLWSLVALTIRLTPRRIHPGIYLAFDLIAFLANVIAGSIGLAVL
FT                   APAMEGGYNCYSAGCDGDAVLRVEIFAYVIVFVNVVVHVMLVVWASWACHVERARRMEK
FT                   NGFEEVEL"
     MSPTSVSDSH PAVLSLRTAA LVTSAAGFIS LAWSITHHKD ISDDGAGGIN SIVLGTIAYA        60
     FLWSLVALTI RLTPRRIHPG IYLAFDLIAF LANVIAGSIG LAVLAPAMEG GYNCYSAGCD       120
     GDAVLRVEIF AYVIVFVNVV VHVMLVVWAS WACHVERARR MEKNGFEEVE L                171
//

If you have problems or comments...

PBIL Back to PBIL home page