(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE110

ASFUM1_4.PE110       Location/Qualifiers
FT   CDS             join(complement(327752..327892),complement(327636..327706),
FT                   complement(327472..327585),complement(326956..327416),
FT                   complement(326133..326914))
FT                   /codon_start=1
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210311"
FT                   /orf_name="AFUA_4G01230"
FT                   /product="GABA permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84297.2"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG054503"
FT                   /db_xref="HOGENOM:HBG325555"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000F51BF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9E4"
FT                   /transl_table=1
FT                   /translation="MTTGTKAPEMASLQMEAGHHASTDAKHSGTVYDDHDMQRMGKVQE
FT                   LKRNLRPLAALSFASVLQATWEFILISNTQGLENGGLAGMVWSYLWTFVGFGFIIASLS
FT                   EMASMAPTSGGQYHWVSEFASPRYQKFLSYLTGWMSVLAWQAGSASGSFLTGTIIQGLI
FT                   SVRYPDYQPERWQGTLFVFAMIVVIYVFNVYAADMMPLFNNLLMILHILSWTVVVIVLW
FT                   AMAPHQSAKAVFTEWTNGGGWSSIGLSALIGQISAIYASLSSDATAHMSEEVKDAGRYV
FT                   PIAIAWGYFSNGVMAIVVVISFLFAIPSVEDALDDATGFPFIYVFKNATSVAGVNGLTA
FT                   IILIPVIFSNILFNASTSRQTFAFARDKGLPFARWIAKVDPRRKIPVNAIALSCIISCL
FT                   LSLINIGSLTAFNAIISLNVAALMYTYIISISCIIYRKIWHPDTLPPRRWDLGRWGLTV
FT                   NIVGLLYCMFALFWALWPSETPVTVDNFNWSVVIFGVVFVLSLVMYAVKGRREYHGPVV
FT                   IVRRD"
     MTTGTKAPEM ASLQMEAGHH ASTDAKHSGT VYDDHDMQRM GKVQELKRNL RPLAALSFAS        60
     VLQATWEFIL ISNTQGLENG GLAGMVWSYL WTFVGFGFII ASLSEMASMA PTSGGQYHWV       120
     SEFASPRYQK FLSYLTGWMS VLAWQAGSAS GSFLTGTIIQ GLISVRYPDY QPERWQGTLF       180
     VFAMIVVIYV FNVYAADMMP LFNNLLMILH ILSWTVVVIV LWAMAPHQSA KAVFTEWTNG       240
     GGWSSIGLSA LIGQISAIYA SLSSDATAHM SEEVKDAGRY VPIAIAWGYF SNGVMAIVVV       300
     ISFLFAIPSV EDALDDATGF PFIYVFKNAT SVAGVNGLTA IILIPVIFSN ILFNASTSRQ       360
     TFAFARDKGL PFARWIAKVD PRRKIPVNAI ALSCIISCLL SLINIGSLTA FNAIISLNVA       420
     ALMYTYIISI SCIIYRKIWH PDTLPPRRWD LGRWGLTVNI VGLLYCMFAL FWALWPSETP       480
     VTVDNFNWSV VIFGVVFVLS LVMYAVKGRR EYHGPVVIVR RD                          522
//

If you have problems or comments...

PBIL Back to PBIL home page