(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE117

ASFUM1_4.PE117       Location/Qualifiers
FT   CDS             join(347605..347843,347897..348013,348069..349065)
FT                   /codon_start=1
FT                   /gene_family="HOG000172710" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274682"
FT                   /orf_name="AFUA_4G01310"
FT                   /product="DUF89 domain protein"
FT                   /protein_id="EAL84289.1"
FT                   /db_xref="HOGENOM:HBG054438"
FT                   /db_xref="HOGENOM:HBG696796"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="UniParc:UPI000051F74C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9F1"
FT                   /transl_table=1
FT                   /translation="MPSATMNAEEVRAVWTSDKGSMAQQTAETRWAKIIQGVIDDIGET
FT                   AGAQDVGCQKRAESIAIQIALKDIKTGIEQNKPLTPLPDDGKLDIQEWNKQLAAIGECS
FT                   WTNCPWLFGECYMYRSIQRMLNSSKHWQNYDVFKRQKDSTFVKSRAAVEELASRYMQIV
FT                   ADTRLAQDESKEAAQKLLFIEMTEIALWGNATDLSLLANLTLEDLQNLQGREAIQKSQR
FT                   NIVDNDTDDVWAYLQRTAGQTRRQIDIILDNAGFEFFTDVLYAAYLLEAGIATSIRLHT
FT                   KEFPWFVSDVIPSDVASLFEHLESSECFPVRKHLDQLVPRLRKLFQSAAITTTSDPFWT
FT                   TPFSFHEMPTKAPALFKELQNSYLVIFKGDLNYRKLTRDGLWPHTTTFETALGPLGKES
FT                   GVKILALRTNKSDVCVGIPTQSKVDALNEEAPDGAWIRNGKYAIVSFSEGQ"
     MPSATMNAEE VRAVWTSDKG SMAQQTAETR WAKIIQGVID DIGETAGAQD VGCQKRAESI        60
     AIQIALKDIK TGIEQNKPLT PLPDDGKLDI QEWNKQLAAI GECSWTNCPW LFGECYMYRS       120
     IQRMLNSSKH WQNYDVFKRQ KDSTFVKSRA AVEELASRYM QIVADTRLAQ DESKEAAQKL       180
     LFIEMTEIAL WGNATDLSLL ANLTLEDLQN LQGREAIQKS QRNIVDNDTD DVWAYLQRTA       240
     GQTRRQIDII LDNAGFEFFT DVLYAAYLLE AGIATSIRLH TKEFPWFVSD VIPSDVASLF       300
     EHLESSECFP VRKHLDQLVP RLRKLFQSAA ITTTSDPFWT TPFSFHEMPT KAPALFKELQ       360
     NSYLVIFKGD LNYRKLTRDG LWPHTTTFET ALGPLGKESG VKILALRTNK SDVCVGIPTQ       420
     SKVDALNEEA PDGAWIRNGK YAIVSFSEGQ                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page