(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE119

ASFUM1_4.PE119       Location/Qualifiers
FT   CDS             join(351462..351602,351669..352618,352673..352928,
FT                   352982..353230)
FT                   /codon_start=1
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16274683"
FT                   /orf_name="AFUA_4G01340"
FT                   /product="MFS monosaccharide transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84286.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG054418"
FT                   /db_xref="HOGENOM:HBG324430"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F743"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9F4"
FT                   /transl_table=1
FT                   /translation="MMHRHFWKTVPGPRLLRLITVVSAVAISYEGMSQGVMGAVNVAPE
FT                   YGHRMGFADEQGKVIKPSLQGGIAAMYYLGALFGAFWAGSFSDAYGRIKGIWLACAWCL
FT                   VGAILQASAVNLAHMLCARVVAGVGVAFIIVIAPSWTAELAPAAHRGQMIAVTFLANFG
FT                   GIALSSWIGFATSFTDYAGGAFRWRFCFACQVIPIFFLVIGTLLIPESPRWLVKVGRND
FT                   EAFEIITKLRGDGDRAHPNVQKEIREIVAVVQMEHESQSSSYLQMFLGIGSGDIHIGRR
FT                   IQLAFWLQVLMQYGTGIAAVVIYSGNIYRTAGFDDFKSNWLSAVCMTCGILGTGIAALT
FT                   LDRVGRRWTLYWGAVVLSVILFTLGGLNRGAVNNPDKAEQYGTGAAAMVFLYVVVFSSS
FT                   WLMIPFIYPTEIFPTWLRAKGNAFGVAGWAVGYGAGSLLVPVMFAGIQEKTFYVFGAAM
FT                   FAYIPIIYCFFPETAGRTLEQIDFLFASKSPFVWEEEKEFAKRMTRFHAEIQKMEIENG
FT                   GYAGEKTGEEFVEV"
     MMHRHFWKTV PGPRLLRLIT VVSAVAISYE GMSQGVMGAV NVAPEYGHRM GFADEQGKVI        60
     KPSLQGGIAA MYYLGALFGA FWAGSFSDAY GRIKGIWLAC AWCLVGAILQ ASAVNLAHML       120
     CARVVAGVGV AFIIVIAPSW TAELAPAAHR GQMIAVTFLA NFGGIALSSW IGFATSFTDY       180
     AGGAFRWRFC FACQVIPIFF LVIGTLLIPE SPRWLVKVGR NDEAFEIITK LRGDGDRAHP       240
     NVQKEIREIV AVVQMEHESQ SSSYLQMFLG IGSGDIHIGR RIQLAFWLQV LMQYGTGIAA       300
     VVIYSGNIYR TAGFDDFKSN WLSAVCMTCG ILGTGIAALT LDRVGRRWTL YWGAVVLSVI       360
     LFTLGGLNRG AVNNPDKAEQ YGTGAAAMVF LYVVVFSSSW LMIPFIYPTE IFPTWLRAKG       420
     NAFGVAGWAV GYGAGSLLVP VMFAGIQEKT FYVFGAAMFA YIPIIYCFFP ETAGRTLEQI       480
     DFLFASKSPF VWEEEKEFAK RMTRFHAEIQ KMEIENGGYA GEKTGEEFVE V                531
//

If you have problems or comments...

PBIL Back to PBIL home page