(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE122

ASFUM1_4.PE122       Location/Qualifiers
FT   CDS             join(complement(362611..362971),complement(362239..362558),
FT                   complement(361058..362185))
FT                   /codon_start=1
FT                   /gene_family="HOG000160714" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905735"
FT                   /orf_name="AFUA_4G01370"
FT                   /product="Pyoverdine/dityrosine biosynthesis family protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84283.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054400"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="UniParc:UPI000052009D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9F7"
FT                   /transl_table=1
FT                   /translation="MPYAGNLPTPTENKVSQIISIISAYRHRSAAVPDRFSEFAPALEK
FT                   QLTETVSKGEPVRFILPSFPFKAPAEGDKRKTLGSLPDKAEEIALQTLDAFADSIAEIH
FT                   QPGATVVIVSDASVYGDLLKIPDADAFAYHQELKKLAASLGLTHLEFVRPGTLAGIVPE
FT                   EAKTLEEYSDHVSKTRNLLDGTLAQAVDPNEDENMRATSKHYDTALPQAEDHEAFKAAM
FT                   LKRGKAYAKLIASSAESTIRLSIHESNNVGKITMNLFPPPTSPDFITPWHGAVAVLADA
FT                   SVRIVDASTVDRDRFEVITNHEGRPWLLREKSDLFDWFGMELDFEPLFPCGMQVRPKEG
FT                   YGPYRFEDVNMKLVRRLALSTAPLLLRGFTMQVEKEVFRSKARELGEIQMWPFGDILEV
FT                   RENADFNMNNVLTREAMPFHYDGVFKTVQDEKTGEWISVPPLFQMFRNRAASQSKGGLT
FT                   LFASSRNLIPLLGPDSIPLEELRKLQWETFTAANEAFGGHKLQLPFIITHPESGVDTFR
FT                   FHEPWPESKCVPGSSEPTLVRVVGWPLAESDALCEKLTRLLYDRRVAYRHQWKAGDFIF
FT                   NDNAMTHHTRTAFEDGHREHWRVHVN"
     MPYAGNLPTP TENKVSQIIS IISAYRHRSA AVPDRFSEFA PALEKQLTET VSKGEPVRFI        60
     LPSFPFKAPA EGDKRKTLGS LPDKAEEIAL QTLDAFADSI AEIHQPGATV VIVSDASVYG       120
     DLLKIPDADA FAYHQELKKL AASLGLTHLE FVRPGTLAGI VPEEAKTLEE YSDHVSKTRN       180
     LLDGTLAQAV DPNEDENMRA TSKHYDTALP QAEDHEAFKA AMLKRGKAYA KLIASSAEST       240
     IRLSIHESNN VGKITMNLFP PPTSPDFITP WHGAVAVLAD ASVRIVDAST VDRDRFEVIT       300
     NHEGRPWLLR EKSDLFDWFG MELDFEPLFP CGMQVRPKEG YGPYRFEDVN MKLVRRLALS       360
     TAPLLLRGFT MQVEKEVFRS KARELGEIQM WPFGDILEVR ENADFNMNNV LTREAMPFHY       420
     DGVFKTVQDE KTGEWISVPP LFQMFRNRAA SQSKGGLTLF ASSRNLIPLL GPDSIPLEEL       480
     RKLQWETFTA ANEAFGGHKL QLPFIITHPE SGVDTFRFHE PWPESKCVPG SSEPTLVRVV       540
     GWPLAESDAL CEKLTRLLYD RRVAYRHQWK AGDFIFNDNA MTHHTRTAFE DGHREHWRVH       600
     VN                                                                      602
//

If you have problems or comments...

PBIL Back to PBIL home page