(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE124

ASFUM1_4.PE124       Location/Qualifiers
FT   CDS             join(366188..366307,366382..366488,366557..366986,
FT                   367046..367443,367497..368901)
FT                   /codon_start=1
FT                   /gene_family="HOG000178543" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210312"
FT                   /orf_name="AFUA_4G01392"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EBA27171.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F51C0A"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA91"
FT                   /transl_table=1
FT                   /translation="MVDATHSTAPVGSDTGVRKFTLSCSRCRASKLKCDRKEPCMECVK
FT                   RNIGHLCTKDERQPRAKRSKIENKDKTPSKRDPPPNGDGEAEAEETAQLLEHFVEGVPR
FT                   PNAYRPAVLGPTPSSVAPDFPNPYWSSNDPKRHGEKLALIREIVDAMPTVEIIDALLEV
FT                   FITRCQGPLGNVVHTPTFLKQAQQFSNCLKLASLDSRVLAVSSTVPMEKLGGYLLALVL
FT                   GLAFHPTPSLLGWTPTPLTLRVEELRASEMHSKTWRSLGLRCLQDGVSLFCGSIASLQA
FT                   AIMLLLDGQENSLALDAVLVTAISGARKLGLHRLGGIKLDASASPVASLENDPAALVEP
FT                   DHIRTEIAIRIWWALVLRDWSRGQALGYYTIHPSQFNTRMPLHINDDDLCPSAWRVTVN
FT                   GEITERPRSEFTMMSYTVHALELAGIVRESIDLRGAPTQQPDGTAESAKLRRHINNKYE
FT                   KYIATLPSYFRLGSTVGLTATGPMAAIPVQRWMLHQQLWSLLLRLHRADLSSPISRASC
FT                   QLLAQNIVSTQAQIQARCAVCGSLSTSETQLFNAAVVLLLDLLFSSKQGDGDSASAHLS
FT                   RLMTRDKIREAIELLRTKSLMEGSSLHDLHLEQVKGSAQRSVVALEALMKLEEGDFDHN
FT                   GTNSSNSAAGNRTREPLAAKDSLRLRITDILRALSGRADPEGAPVQEPQAPMDPLSPFQ
FT                   VSMPFANVPDGFHDLDVLPILSNGLSPNFWQFLDFPPPPFDSHPKEVSLATQGDPPGAF
FT                   GLGPSQFPDSYSSTPSTRMTHTSPSLQSESIGLGGGSDSATTPSSADAYVAAKFYYAMG
FT                   DGTLAPM"
     MVDATHSTAP VGSDTGVRKF TLSCSRCRAS KLKCDRKEPC MECVKRNIGH LCTKDERQPR        60
     AKRSKIENKD KTPSKRDPPP NGDGEAEAEE TAQLLEHFVE GVPRPNAYRP AVLGPTPSSV       120
     APDFPNPYWS SNDPKRHGEK LALIREIVDA MPTVEIIDAL LEVFITRCQG PLGNVVHTPT       180
     FLKQAQQFSN CLKLASLDSR VLAVSSTVPM EKLGGYLLAL VLGLAFHPTP SLLGWTPTPL       240
     TLRVEELRAS EMHSKTWRSL GLRCLQDGVS LFCGSIASLQ AAIMLLLDGQ ENSLALDAVL       300
     VTAISGARKL GLHRLGGIKL DASASPVASL ENDPAALVEP DHIRTEIAIR IWWALVLRDW       360
     SRGQALGYYT IHPSQFNTRM PLHINDDDLC PSAWRVTVNG EITERPRSEF TMMSYTVHAL       420
     ELAGIVRESI DLRGAPTQQP DGTAESAKLR RHINNKYEKY IATLPSYFRL GSTVGLTATG       480
     PMAAIPVQRW MLHQQLWSLL LRLHRADLSS PISRASCQLL AQNIVSTQAQ IQARCAVCGS       540
     LSTSETQLFN AAVVLLLDLL FSSKQGDGDS ASAHLSRLMT RDKIREAIEL LRTKSLMEGS       600
     SLHDLHLEQV KGSAQRSVVA LEALMKLEEG DFDHNGTNSS NSAAGNRTRE PLAAKDSLRL       660
     RITDILRALS GRADPEGAPV QEPQAPMDPL SPFQVSMPFA NVPDGFHDLD VLPILSNGLS       720
     PNFWQFLDFP PPPFDSHPKE VSLATQGDPP GAFGLGPSQF PDSYSSTPST RMTHTSPSLQ       780
     SESIGLGGGS DSATTPSSAD AYVAAKFYYA MGDGTLAPM                              819
//

If you have problems or comments...

PBIL Back to PBIL home page