(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE125

ASFUM1_4.PE125       Location/Qualifiers
FT   CDS             join(complement(369512..369944),complement(369123..369442))
FT                   /codon_start=1
FT                   /gene_family="HOG000063193" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274685"
FT                   /orf_name="AFUA_4G01400"
FT                   /product="ThiJ/PfpI family protein "
FT                   /protein_id="EAL84279.2"
FT                   /db_xref="HOGENOM:HBG051612"
FT                   /db_xref="HOGENOM:HBG695952"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI0000F51C0D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G1"
FT                   /transl_table=1
FT                   /translation="MPTQHRILALVYNEFEALDLFGPLGAIVPRSDYYTLALVSLHNLD
FT                   SPHGVETSMKNGIGVIPTLSLAEALREDQQFDTLFIPGGFGMMPLVWDPILLQRIGQLV
FT                   DRAPNVFSVCTGSILLAATGRLDGRKATTNKRLYDELTPKHPGVQWQKRARWVQDGKFL
FT                   TSSGVTAGIDAGFAFLASTYVAPEDRQAHPEAQKASLQGDETPIPGFNKEKALRHAHFI
FT                   AFGLEYRWHSDPADDPFVDLPEQTAART"
     MPTQHRILAL VYNEFEALDL FGPLGAIVPR SDYYTLALVS LHNLDSPHGV ETSMKNGIGV        60
     IPTLSLAEAL REDQQFDTLF IPGGFGMMPL VWDPILLQRI GQLVDRAPNV FSVCTGSILL       120
     AATGRLDGRK ATTNKRLYDE LTPKHPGVQW QKRARWVQDG KFLTSSGVTA GIDAGFAFLA       180
     STYVAPEDRQ AHPEAQKASL QGDETPIPGF NKEKALRHAH FIAFGLEYRW HSDPADDPFV       240
     DLPEQTAART                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page