(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE126

ASFUM1_4.PE126       Location/Qualifiers
FT   CDS             371597..372460
FT                   /codon_start=1
FT                   /gene_family="HOG000178532" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210313"
FT                   /orf_name="AFUA_4G01410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84278.1"
FT                   /db_xref="HOGENOM:HBG054365"
FT                   /db_xref="UniParc:UPI000051F9B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G2"
FT                   /transl_table=1
FT                   /translation="MQCARSGSSTPMGRDPDARWVQWLALTRRNNHAPLSGAMSPSSSP
FT                   SLPMASSNLNYSSRVHSRSSATSYFALMSAAKDGHQHQHQREEDRKQHYYNGSGTPTRR
FT                   HMDTSWVAWLNEHGHQRCQGGRCPSETPGQLQQPQTCLPDSIVMPSSFLDTPPFTTNTP
FT                   PSMISSSATELPSPLAPLTDAEIDAMSQQFPDFADRFPAEFSDATTAMGPFDPAELDAG
FT                   LLTWLDEQHSFAFHQGEDVAVSPSKRSLTLETYPREMSADGTRREGGIKKQKVYHETYT
FT                   EPGKSA"
     MQCARSGSST PMGRDPDARW VQWLALTRRN NHAPLSGAMS PSSSPSLPMA SSNLNYSSRV        60
     HSRSSATSYF ALMSAAKDGH QHQHQREEDR KQHYYNGSGT PTRRHMDTSW VAWLNEHGHQ       120
     RCQGGRCPSE TPGQLQQPQT CLPDSIVMPS SFLDTPPFTT NTPPSMISSS ATELPSPLAP       180
     LTDAEIDAMS QQFPDFADRF PAEFSDATTA MGPFDPAELD AGLLTWLDEQ HSFAFHQGED       240
     VAVSPSKRSL TLETYPREMS ADGTRREGGI KKQKVYHETY TEPGKSA                     287
//

If you have problems or comments...

PBIL Back to PBIL home page