(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE127

ASFUM1_4.PE127       Location/Qualifiers
FT   CDS             complement(373174..374814)
FT                   /codon_start=1
FT                   /gene_family="HOG000178521" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753599"
FT                   /orf_name="AFUA_4G01420"
FT                   /product="Spore wall assembly protein Dit1, putative "
FT                   /protein_id="EAL84277.1"
FT                   /db_xref="HOGENOM:HBG054359"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="UniParc:UPI00005202DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G3"
FT                   /transl_table=1
FT                   /translation="MLSNTITIVPSIETRVVEPLPQFDTSRRLSFPVSLPLDSLAGARK
FT                   KAANEALVERIAEIIASYRISGPDDRYEVVYKPKLLDTLRYFVSKQEPVNMVVPAYPFK
FT                   SPNRDEKVLGPDPDVGERMSLEHFNSMGARIQQIYPPGGYVTIVSDGCCYNDLLGVSDE
FT                   EVFRYAEGLHRIVDRLGLKHIKFSDPFDLIEGRHNVPVTEEEYASRIGELKDYLFRSYH
FT                   PDGYDFDEELSKDPNAALTYRGYIRFLMSDLALFFKERQMSKNAIKKHCSTVARSMIKR
FT                   GKAFSALVARASPLHVRLSIHASDNTGKLSVALLPHKRYSTFPVTPWHNTPYLDTTSVS
FT                   LSLSRKPTDGATPYRLCQDELGLHFLCADVPMYRVIETPDLPALAQQVQFQPLYPFGLR
FT                   IKVPRGTPIGQFRLERVAELAKVHSPIIFEGLDPMEYTAAIADDFQRVAGGTMSLSILH
FT                   EGVATTANTARHLGGSAAASYFLQISAATGDDAQPALLPFLAAAAALDDVRYRVLHHWQ
FT                   AGHAVVSDHRVALPVHLSPSSLRVLHGGV"
     MLSNTITIVP SIETRVVEPL PQFDTSRRLS FPVSLPLDSL AGARKKAANE ALVERIAEII        60
     ASYRISGPDD RYEVVYKPKL LDTLRYFVSK QEPVNMVVPA YPFKSPNRDE KVLGPDPDVG       120
     ERMSLEHFNS MGARIQQIYP PGGYVTIVSD GCCYNDLLGV SDEEVFRYAE GLHRIVDRLG       180
     LKHIKFSDPF DLIEGRHNVP VTEEEYASRI GELKDYLFRS YHPDGYDFDE ELSKDPNAAL       240
     TYRGYIRFLM SDLALFFKER QMSKNAIKKH CSTVARSMIK RGKAFSALVA RASPLHVRLS       300
     IHASDNTGKL SVALLPHKRY STFPVTPWHN TPYLDTTSVS LSLSRKPTDG ATPYRLCQDE       360
     LGLHFLCADV PMYRVIETPD LPALAQQVQF QPLYPFGLRI KVPRGTPIGQ FRLERVAELA       420
     KVHSPIIFEG LDPMEYTAAI ADDFQRVAGG TMSLSILHEG VATTANTARH LGGSAAASYF       480
     LQISAATGDD AQPALLPFLA AAAALDDVRY RVLHHWQAGH AVVSDHRVAL PVHLSPSSLR       540
     VLHGGV                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page