(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE129

ASFUM1_4.PE129       Location/Qualifiers
FT   CDS             join(complement(376585..376615),complement(376310..376533),
FT                   complement(375829..376266))
FT                   /codon_start=1
FT                   /gene_family="HOG000125752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274687"
FT                   /orf_name="AFUA_4G01440"
FT                   /product="Glutathione S-transferase family protein "
FT                   /function="transferase activity"
FT                   /protein_id="EAL84275.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG054344"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000051E695"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G5"
FT                   /transl_table=1
FT                   /translation="MAPFTLYTHAGPGPNPVKVAMALEHLGLDYDCIPLAFGEGKGTVK
FT                   DPEYTSKVNPNGRVPGLIDHENNDFTVFESAAILQYLAEKTIQYDTSGKLAGSTPEERA
FT                   TVNKWLAWQVSGLGPYQGQLVWFLAFHEGAHGEKPNGSVIARYQAEVERLRSVLEKHLA
FT                   SAENGFVALGRLTIADFAILPWLKISVLAGSALKSFEEYPAINAYIKKLDALPEVQAAY
FT                   KKAVPPMQ"
     MAPFTLYTHA GPGPNPVKVA MALEHLGLDY DCIPLAFGEG KGTVKDPEYT SKVNPNGRVP        60
     GLIDHENNDF TVFESAAILQ YLAEKTIQYD TSGKLAGSTP EERATVNKWL AWQVSGLGPY       120
     QGQLVWFLAF HEGAHGEKPN GSVIARYQAE VERLRSVLEK HLASAENGFV ALGRLTIADF       180
     AILPWLKISV LAGSALKSFE EYPAINAYIK KLDALPEVQA AYKKAVPPMQ                  230
//

If you have problems or comments...

PBIL Back to PBIL home page