(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE130

ASFUM1_4.PE130       Location/Qualifiers
FT   CDS             join(complement(378920..378960),complement(378444..378870),
FT                   complement(378126..378384),complement(377634..378073))
FT                   /codon_start=1
FT                   /gene_family="HOG000220501" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210314"
FT                   /orf_name="AFUA_4G01450"
FT                   /product="Phospho-2-dehydro-3-deoxyheptonate aldolase "
FT                   /EC_number="2.5.1.54"
FT                   /function="3-deoxy-7-phosphoheptulonate synthase activity "
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /protein_id="EAL84274.1"
FT                   /db_xref="GO:0003849"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="HOGENOM:HBG054336"
FT                   /db_xref="HOGENOM:HBG670536"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000052009C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G6"
FT                   /transl_table=1
FT                   /translation="MLATPGVISRGPEVPHTRPHLLAGSIVPEPSSPLKDSNVAAYEPL
FT                   IPPALLLHEFPVTPASRRTIESARQGAARIIQRNGDDRLLVIVGPCSIHDTDVARDYAV
FT                   RLQAAIQEHGWDKDLLIVMRAYLEKPRTTVGWKGFLYDPNIDSTNQVNMGLKVARKLLL
FT                   DITALGLPVACEVLDTISPQFLADLYSWGAVGARTTESQVHRQLVSGLSFPIGFKNGSS
FT                   GNITNACDAMKSASSPHSFLGVTEQGLAAIVHTKGNPHLHVIHRGGDSGPNFDAASVAS
FT                   TIKAYPKNLQPSIMIDASHGNSQKDYRNQPKVIDAVASQIAAGEPAITGVMIESNINEG
FT                   KQAAPQSEDEVQKLKYGVSITDGCVGFETTVKMLETLSQVRETVLYKD"
     MLATPGVISR GPEVPHTRPH LLAGSIVPEP SSPLKDSNVA AYEPLIPPAL LLHEFPVTPA        60
     SRRTIESARQ GAARIIQRNG DDRLLVIVGP CSIHDTDVAR DYAVRLQAAI QEHGWDKDLL       120
     IVMRAYLEKP RTTVGWKGFL YDPNIDSTNQ VNMGLKVARK LLLDITALGL PVACEVLDTI       180
     SPQFLADLYS WGAVGARTTE SQVHRQLVSG LSFPIGFKNG SSGNITNACD AMKSASSPHS       240
     FLGVTEQGLA AIVHTKGNPH LHVIHRGGDS GPNFDAASVA STIKAYPKNL QPSIMIDASH       300
     GNSQKDYRNQ PKVIDAVASQ IAAGEPAITG VMIESNINEG KQAAPQSEDE VQKLKYGVSI       360
     TDGCVGFETT VKMLETLSQV RETVLYKD                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page