(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE132

ASFUM1_4.PE132       Location/Qualifiers
FT   CDS             join(complement(384201..384448),complement(383936..384150),
FT                   complement(383789..383889),complement(382033..383730))
FT                   /codon_start=1
FT                   /gene_family="HOG000178498" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059010"
FT                   /orf_name="AFUA_4G01470"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84272.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054318"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051EFEE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G8"
FT                   /transl_table=1
FT                   /translation="MTVQASSPNPVSELEPLGKPNPPAPAGQSQPNPPPKKGKDKKIFS
FT                   CHSCRRRKLKCDRFDPCGACQARGEGHLCTWEEGQRPERNHRESLEQLPKLILKLTAEV
FT                   QELKTSNSALVENIRNNGKELAESLDLTPLDSRPPSHLRSGSSSAGYISWDLSCRIPDH
FT                   QQWTPSQLLALLPESQLLWGLISHYISASASLTSFIDVHQLVRDVEEVQHLRQGLDLSS
FT                   SSALLGHLDIKVSMILACASLAAVDLDPGKAQELGLANTDIDALVRDLWKGSRTLISRS
FT                   DLDPLLPTSKAVLSEGRAAPSLEASNDLLQQSGARIAAATDIQVQVVSIRILLLLAARS
FT                   FAAPSEYLKLHLDVISSAIDASLDSPYDEGTHLIDREWRWQLWSFICLLDWTSPGIYHT
FT                   SSYFIRPEMHRGPPSKVPGLPDHGSYPSAIEKVHWDRLSQTRHYLEYALALAHLSRRAE
FT                   DCIVRPGPVSPAQAAELCTELDALDNKLSFYQLLGSTAPDGGTFSTGGRPVDATSITGD
FT                   LATDKASTEHRRFLARAPVIQSMHLSLELGLIRFKLFRHEVFHLMQAPSTSGTLRMICM
FT                   DACMDACILVLAQCWSIGDRDVPGVQAQAQAQSQMSLDPSEEKRPCTGSLRRVLQPASS
FT                   AALVGQVLLHAAQGVDGMGMGSGNGKQCQGNGAVGSRGLSATEFFTFVEGGGEFATTSG
FT                   TVSGQGPYTAAGGSWSGRMIREKVKVLQWHVSKVLTLLEALQGTSPLARYKMSLHQQCM
FT                   "
     MTVQASSPNP VSELEPLGKP NPPAPAGQSQ PNPPPKKGKD KKIFSCHSCR RRKLKCDRFD        60
     PCGACQARGE GHLCTWEEGQ RPERNHRESL EQLPKLILKL TAEVQELKTS NSALVENIRN       120
     NGKELAESLD LTPLDSRPPS HLRSGSSSAG YISWDLSCRI PDHQQWTPSQ LLALLPESQL       180
     LWGLISHYIS ASASLTSFID VHQLVRDVEE VQHLRQGLDL SSSSALLGHL DIKVSMILAC       240
     ASLAAVDLDP GKAQELGLAN TDIDALVRDL WKGSRTLISR SDLDPLLPTS KAVLSEGRAA       300
     PSLEASNDLL QQSGARIAAA TDIQVQVVSI RILLLLAARS FAAPSEYLKL HLDVISSAID       360
     ASLDSPYDEG THLIDREWRW QLWSFICLLD WTSPGIYHTS SYFIRPEMHR GPPSKVPGLP       420
     DHGSYPSAIE KVHWDRLSQT RHYLEYALAL AHLSRRAEDC IVRPGPVSPA QAAELCTELD       480
     ALDNKLSFYQ LLGSTAPDGG TFSTGGRPVD ATSITGDLAT DKASTEHRRF LARAPVIQSM       540
     HLSLELGLIR FKLFRHEVFH LMQAPSTSGT LRMICMDACM DACILVLAQC WSIGDRDVPG       600
     VQAQAQAQSQ MSLDPSEEKR PCTGSLRRVL QPASSAALVG QVLLHAAQGV DGMGMGSGNG       660
     KQCQGNGAVG SRGLSATEFF TFVEGGGEFA TTSGTVSGQG PYTAAGGSWS GRMIREKVKV       720
     LQWHVSKVLT LLEALQGTSP LARYKMSLHQ QCM                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page