(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE140

ASFUM1_4.PE140       Location/Qualifiers
FT   CDS             join(415070..416049,416102..416369,416417..416755,
FT                   416805..417140)
FT                   /codon_start=1
FT                   /gene_family="HOG000158970" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16274693"
FT                   /orf_name="AFUA_4G01560"
FT                   /product="MFS myo-inositol transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84263.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG054723"
FT                   /db_xref="HOGENOM:HBG324208"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F4D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9H7"
FT                   /transl_table=1
FT                   /translation="MVEKSSDPEVPSLSHHESSISIEKQGDAATAREWAQDVNSTTTNT
FT                   KLKNPLAGLTREQLLNDVEAFAKEKDLEHILDDLRKGALVAQDPREFEQMDALTESEKE
FT                   LLRREKTHRWSQPFMMYFMTSESSRYPPTEFGFNPACQSSVLDLLSCREWIRLLSTVRR
FT                   SMYSSITHLSYAKQSRFYFAEFNVTDTWMQGLLNGAPYLCSAVIGCWTTAPLNRWFGRR
FT                   GCIFISCFISFASSFWMAAAHTWWNLLLGRFLLGFAVGAKSTTTPVYGAECSPANIRGA
FT                   LVMMWQMWTAFGIMLGYIASVAFMDVTHPTIPGFNWRLMLGSTAIPPFFVCIQVYFCPE
FT                   SPRWYMMRNRYHDAYKALCKFRPSTFQAARDLYYIHAALKVEEKLREGKHLFREMFTIP
FT                   RNRRAAQSSFFVMFMQQFCGVNAIMYYSSSMFREAGFDTRMALITSLGCGITNWIFALP
FT                   AVYTIDTFGRRNLLLTTFPLMCIFLLFTGFSFYIPDQTSRTACVATGIYLFMIVYSPGE
FT                   GPVPFTYSAEAFPLYIRDIGMSFATATTWGFNFIVSLTWPSLNKSFTPTGAFGWYAAWN
FT                   FFGWIFCYFCLPETKALSLEELDQVFSVPTTKHVNHYRAMLPWYVKKYLLRRDVPPQNQ
FT                   LYDYY"
     MVEKSSDPEV PSLSHHESSI SIEKQGDAAT AREWAQDVNS TTTNTKLKNP LAGLTREQLL        60
     NDVEAFAKEK DLEHILDDLR KGALVAQDPR EFEQMDALTE SEKELLRREK THRWSQPFMM       120
     YFMTSESSRY PPTEFGFNPA CQSSVLDLLS CREWIRLLST VRRSMYSSIT HLSYAKQSRF       180
     YFAEFNVTDT WMQGLLNGAP YLCSAVIGCW TTAPLNRWFG RRGCIFISCF ISFASSFWMA       240
     AAHTWWNLLL GRFLLGFAVG AKSTTTPVYG AECSPANIRG ALVMMWQMWT AFGIMLGYIA       300
     SVAFMDVTHP TIPGFNWRLM LGSTAIPPFF VCIQVYFCPE SPRWYMMRNR YHDAYKALCK       360
     FRPSTFQAAR DLYYIHAALK VEEKLREGKH LFREMFTIPR NRRAAQSSFF VMFMQQFCGV       420
     NAIMYYSSSM FREAGFDTRM ALITSLGCGI TNWIFALPAV YTIDTFGRRN LLLTTFPLMC       480
     IFLLFTGFSF YIPDQTSRTA CVATGIYLFM IVYSPGEGPV PFTYSAEAFP LYIRDIGMSF       540
     ATATTWGFNF IVSLTWPSLN KSFTPTGAFG WYAAWNFFGW IFCYFCLPET KALSLEELDQ       600
     VFSVPTTKHV NHYRAMLPWY VKKYLLRRDV PPQNQLYDYY                             640
//

If you have problems or comments...

PBIL Back to PBIL home page