(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE141

ASFUM1_4.PE141       Location/Qualifiers
FT   CDS             join(417904..418091,418717..419116,419162..419359,
FT                   420051..420212)
FT                   /codon_start=1
FT                   /gene_family="HOG000048697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210316"
FT                   /orf_name="AFUA_4G01570"
FT                   /product="Amino acid transporter, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84262.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG054612"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI00005202E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9H8"
FT                   /transl_table=1
FT                   /translation="MGSMHEAGSRPAAGADMDTDRVHPEAVSDNERDFEKQDSKPEYQD
FT                   AFGDEEYAEVKYKTLSWCVFSAVLIVMIAVGVQRPWHGGLNATVDTNLYKAFLAVCNIV
FT                   FSFCRLFLHFSSFMDRTNKTAGHVAFFGFMAELRNPRDYPKSLFLLQGIDTCLYIIAAV
FT                   VIYCYAGDDVTSPALGSASTIVKKVAYGIALPTIIIGGVVNGHVACKYIYVRMWRHSDR
FT                   MHKRDLVATGSWVLIGLATWIVAWIIAEAIPVFNNLLSLVREVLVVICTMIWERVLIAP
FT                   SVTAFRQPGTPDQPTEHLFPLALFVATRDPRSIG"
     MGSMHEAGSR PAAGADMDTD RVHPEAVSDN ERDFEKQDSK PEYQDAFGDE EYAEVKYKTL        60
     SWCVFSAVLI VMIAVGVQRP WHGGLNATVD TNLYKAFLAV CNIVFSFCRL FLHFSSFMDR       120
     TNKTAGHVAF FGFMAELRNP RDYPKSLFLL QGIDTCLYII AAVVIYCYAG DDVTSPALGS       180
     ASTIVKKVAY GIALPTIIIG GVVNGHVACK YIYVRMWRHS DRMHKRDLVA TGSWVLIGLA       240
     TWIVAWIIAE AIPVFNNLLS LVREVLVVIC TMIWERVLIA PSVTAFRQPG TPDQPTEHLF       300
     PLALFVATRD PRSIG                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page