(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE151

ASFUM1_4.PE151       Location/Qualifiers
FT   CDS             join(762040..762396,762515..762523)
FT                   /codon_start=1
FT                   /gene_family="HOG000048686" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905739"
FT                   /orf_name="AFUA_4G02740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84422.1"
FT                   /db_xref="HOGENOM:HBG054332"
FT                   /db_xref="UniParc:UPI000051E816"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA41"
FT                   /transl_table=1
FT                   /translation="MSGMIISMPPGYRLSSRISGDIALISCLAKSLRDPHQHDENKIMS
FT                   RTPRSMQARIGMSISSQWPERSAYWRSDEGFSVHHLTLAWMITEADMHDACRQDGSEAE
FT                   KVEDVLLQRVQLPELDR"
     MSGMIISMPP GYRLSSRISG DIALISCLAK SLRDPHQHDE NKIMSRTPRS MQARIGMSIS        60
     SQWPERSAYW RSDEGFSVHH LTLAWMITEA DMHDACRQDG SEAEKVEDVL LQRVQLPELD       120
     R                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page