(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE153

ASFUM1_4.PE153       Location/Qualifiers
FT   CDS             join(764140..764270,764445..765288)
FT                   /codon_start=1
FT                   /gene_family="HOG000217304" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059013"
FT                   /orf_name="AFUA_4G02760"
FT                   /product="DUF829 domain protein (PaxU), putative "
FT                   /protein_id="EAL84424.1"
FT                   /db_xref="HOGENOM:HBG054333"
FT                   /db_xref="InterPro:IPR008547"
FT                   /db_xref="UniParc:UPI000051E817"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA39"
FT                   /transl_table=1
FT                   /translation="MNVKAKKRIGQLDQYWGQKNWRLCQVEKEMKGMAYNGEGAAPFLS
FT                   VIPHFTRIATRTWLSTPDKALPGQLVIVCTWLGASAKHITKYTDLHRSIAPHARILLIE
FT                   SEVSILVSSYARQRRLIRPAVDVVLETLADRTESDAPRILLHTFSNGGTNTATQLLITL
FT                   AKTVSQPLPLVGLVLDSTPARGTYWKSYNAMVFSLPPSSRLVGSVVVHFLLILLYTWIA
FT                   CGNENPASLMRRTLLDEETVGPAPQRDAPGYVCYMYSKEDRMTDWRDVWDHAQEAEEKG
FT                   WKVDKVLFEGTGHCAHMPDNPARYAEAVEKAWNSALCKIESKL"
     MNVKAKKRIG QLDQYWGQKN WRLCQVEKEM KGMAYNGEGA APFLSVIPHF TRIATRTWLS        60
     TPDKALPGQL VIVCTWLGAS AKHITKYTDL HRSIAPHARI LLIESEVSIL VSSYARQRRL       120
     IRPAVDVVLE TLADRTESDA PRILLHTFSN GGTNTATQLL ITLAKTVSQP LPLVGLVLDS       180
     TPARGTYWKS YNAMVFSLPP SSRLVGSVVV HFLLILLYTW IACGNENPAS LMRRTLLDEE       240
     TVGPAPQRDA PGYVCYMYSK EDRMTDWRDV WDHAQEAEEK GWKVDKVLFE GTGHCAHMPD       300
     NPARYAEAVE KAWNSALCKI ESKL                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page