(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE156

ASFUM1_4.PE156       Location/Qualifiers
FT   CDS             join(complement(771605..771649),complement(770570..771457))
FT                   /codon_start=1
FT                   /gene_family="HOG000161070" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274697"
FT                   /orf_name="AFUA_4G02790"
FT                   /product="Carbon-nitrogen family hydrolase, putative "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="EAL84427.1"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG054337"
FT                   /db_xref="HOGENOM:HBG330305"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniParc:UPI0000520904"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA36"
FT                   /transl_table=1
FT                   /translation="MPPFCKIAVIQLYVKPLKPEDNFARAVKFITEAAAQGCHLAVLPE
FT                   FHLTNWIPTDPRFASLCNDWETYLHRYQALAKERNICIVPGSIVRPVSASPTAAAGATV
FT                   SDKQTPSLENVTFFISNTGEILGSYVKKNLWGPTERAYLRSSGDSPHQVISTPLGPVGL
FT                   LVCWDLAFPEAWRELASQGAKIIIVPTLWTRSGASEAGHRQNPSAPSLFLDSILTARTF
FT                   ENTCAVVFANAGGPPGRNYCGLSQINIPYAGPLVRLGTSAEGMGVATLDLAVLEDAEEN
FT                   YAIRSDLTDPSWHYRHTRRVPVESPKGRL"
     MPPFCKIAVI QLYVKPLKPE DNFARAVKFI TEAAAQGCHL AVLPEFHLTN WIPTDPRFAS        60
     LCNDWETYLH RYQALAKERN ICIVPGSIVR PVSASPTAAA GATVSDKQTP SLENVTFFIS       120
     NTGEILGSYV KKNLWGPTER AYLRSSGDSP HQVISTPLGP VGLLVCWDLA FPEAWRELAS       180
     QGAKIIIVPT LWTRSGASEA GHRQNPSAPS LFLDSILTAR TFENTCAVVF ANAGGPPGRN       240
     YCGLSQINIP YAGPLVRLGT SAEGMGVATL DLAVLEDAEE NYAIRSDLTD PSWHYRHTRR       300
     VPVESPKGRL                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page