(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE157

ASFUM1_4.PE157       Location/Qualifiers
FT   CDS             join(772607..773002,773070..773576)
FT                   /codon_start=1
FT                   /gene_family="HOG000048685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274698"
FT                   /orf_name="AFUA_4G02800"
FT                   /product="Haemolysin-III family protein "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84428.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG054338"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniParc:UPI000051FB40"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA35"
FT                   /transl_table=1
FT                   /translation="MAMTTVRLAFSYLLSPSSPKVVGNPPVKVSESLKKQRVFHASQIP
FT                   AWMQWDPYILHGYRGQLDSYGQCFWSLFYLHNESVNTWSHIIPGMYFLTLLLAIDYWII
FT                   QLPLEVPVMDILAIQTYVAGTAGCLIFSAAFHATNAHSPEVAHAFLKLDYLGIVMTITT
FT                   TCISVTYFALYSYPILQVTYIFLTVLCAATIFWVALDPRMDGARAGPWRSVFAMPLLAL
FT                   QRPDSANLLCRAAVFFLLATSGLAPIFHVIWAEASYGLIRIPLDSLTVTCSSYAVGTAV
FT                   YVTRFPERFWPARFDLIVS"
     MAMTTVRLAF SYLLSPSSPK VVGNPPVKVS ESLKKQRVFH ASQIPAWMQW DPYILHGYRG        60
     QLDSYGQCFW SLFYLHNESV NTWSHIIPGM YFLTLLLAID YWIIQLPLEV PVMDILAIQT       120
     YVAGTAGCLI FSAAFHATNA HSPEVAHAFL KLDYLGIVMT ITTTCISVTY FALYSYPILQ       180
     VTYIFLTVLC AATIFWVALD PRMDGARAGP WRSVFAMPLL ALQRPDSANL LCRAAVFFLL       240
     ATSGLAPIFH VIWAEASYGL IRIPLDSLTV TCSSYAVGTA VYVTRFPERF WPARFDLIVS       300
//

If you have problems or comments...

PBIL Back to PBIL home page