(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE163

ASFUM1_4.PE163       Location/Qualifiers
FT   CDS             join(795073..795205,795386..795591)
FT                   /codon_start=1
FT                   /gene_family="HOG000048684" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274702"
FT                   /orf_name="AFUA_4G02850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84433.1"
FT                   /db_xref="HOGENOM:HBG054342"
FT                   /db_xref="UniParc:UPI000051FFCF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA30"
FT                   /transl_table=1
FT                   /translation="MSSIPRTSRVVFVNRNTCLFNYRIAINNSLLSCPDDPDPGFSLVA
FT                   SRWQTVEPSSVHFLTHGRQGESVAITDLVESGGTVGAARRRAGPGAGAGTGPGAAERVD
FT                   RGSAGGGG"
     MSSIPRTSRV VFVNRNTCLF NYRIAINNSL LSCPDDPDPG FSLVASRWQT VEPSSVHFLT        60
     HGRQGESVAI TDLVESGGTV GAARRRAGPG AGAGTGPGAA ERVDRGSAGG GG               112
//

If you have problems or comments...

PBIL Back to PBIL home page