(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE167

ASFUM1_4.PE167       Location/Qualifiers
FT   CDS             join(806022..806572,806970..807123)
FT                   /codon_start=1
FT                   /gene_family="HOG000217297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274706"
FT                   /orf_name="AFUA_4G02890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84437.1"
FT                   /db_xref="HOGENOM:HBG054345"
FT                   /db_xref="UniParc:UPI000051F897"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA26"
FT                   /transl_table=1
FT                   /translation="MQQVYTHEGPYESIPSTASPGLQFLRHFLPALDSLDPTTNPISRF
FT                   IHPDARVVVGSGPPNRGTDVIGLLNVRQRHIQRFQHEIHKAWDIARPDTGNGNGGPRTV
FT                   MFEATSGTVFRNDPDEFEVQVREFNILELQRAGSQSNGDGEGKGGFVAVEMRTFMDARP
FT                   VQDQAARLQRESAYGEAKSTGWDHSTLNCRTSLQWVQPGWQHRIELCEVQSLTLISQLG
FT                   FLSGPAVAANVY"
     MQQVYTHEGP YESIPSTASP GLQFLRHFLP ALDSLDPTTN PISRFIHPDA RVVVGSGPPN        60
     RGTDVIGLLN VRQRHIQRFQ HEIHKAWDIA RPDTGNGNGG PRTVMFEATS GTVFRNDPDE       120
     FEVQVREFNI LELQRAGSQS NGDGEGKGGF VAVEMRTFMD ARPVQDQAAR LQRESAYGEA       180
     KSTGWDHSTL NCRTSLQWVQ PGWQHRIELC EVQSLTLISQ LGFLSGPAVA ANVY             234
//

If you have problems or comments...

PBIL Back to PBIL home page