(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE168

ASFUM1_4.PE168       Location/Qualifiers
FT   CDS             join(807605..811417,811473..811787)
FT                   /codon_start=1
FT                   /gene_family="HOG000171704" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274707"
FT                   /orf_name="AFUA_4G02900"
FT                   /product="Sensor histidine kinase/response regulator,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="G-protein coupled photoreceptor activity "
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="protein-chromophore linkage "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="sensory perception"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84438.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0007600"
FT                   /db_xref="GO:0008020"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="GO:0018298"
FT                   /db_xref="HOGENOM:HBG054346"
FT                   /db_xref="HOGENOM:HBG327489"
FT                   /db_xref="InterPro:IPR001294"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR013654"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="UniParc:UPI000051FFB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA25"
FT                   /transl_table=1
FT                   /translation="MASRANASSPTRQKNDEDLSETTSGAVGEEGAVTRAPKSGMESST
FT                   GFESEDRVYPIRSVISVDPSTVSQSQQQAESNLSSPATGAREWSIINAETWDKMRAQTK
FT                   TSAGNFSATEPPPPAPDTAGSSSEPPDQGRSHSASPTPTPDSALTKTQDPEVDSEHGLV
FT                   TARFRHVVTDGGHMVITGRANDSYQACEDEPIHIPGAVQSFGCLLVLREEIEGKLVVRV
FT                   ASENSEVILGHSPKCLFALPNFCDILDEEQKDNLLDHLDLIRDDGFDPSVDGPEVFLLS
FT                   VKLPSGKPRRFWCATHLSPADSNSIICEFELEDDRINPLSVSGLTTPVTPTDTLGVEPT
FT                   PEQLEHSTVNISQPLRLLRNARRRRGEAAAMEVFSILSQIQDQLGRTKSLDSLLNTTTG
FT                   LVKELTGFHRVLIYQFDTEWNGTVVAELVDPKASVDLYKGLCFPASDIPKQARDLYRIN
FT                   KVRLLYDRDQVTSRLVCRTLEDLQTPVDMTHSYLRAMSPIHLKYLANMGVRASMSISIS
FT                   GFNELWGLISCHTYGTHGMRVSFPVRKICRLIGDTVSRNIERLSYASRLQARKLINTVP
FT                   TDQNPSGYIIATSDDLLKLFDADYGALSIRNETKLLGKMTHSQEILALLEYLRMQRMNS
FT                   VVASHHITKDFPDLFYAPGFKHISGMLYVPLSAGGTDFMVFFRRGHLTEIKWAGNPYDK
FT                   KPQNGHLEPRKSFQTWRETVLDQSREWTESDVETAAVLCLVYGKFIKVWRQKEAAMENS
FT                   QLTRLLLANSAHEFRTPLNAVINYLEIALEGSLDPETRDNLTKSYSASKSLIYVINDLL
FT                   DLTNAEKGQKLIKDEIFDLPATFREATDMFEGEAKRKSIHYKVVAHPGLPPAVIGDQRR
FT                   VRQVFTNLISNAVRHTTAGSVTTEIWRSLEQAQPGCVVVQMTVLDTGSGMSQSTLEALF
FT                   QELEQVSTDDDNYWFDPEDQTHPLDSCSQDKRVLGLGLALVARIVRNMHGQLSVRSEKG
FT                   KGSYFEISLNFPVPDDVASGESEEPSVPDIVEPAVPIQQEVEFMLVDSKSTRGGEQRRR
FT                   STGSDHSKGSYNSSRSGRSNRSEADRLISAMQDSPLLQRTTSEGSEERDPRPVERTQGS
FT                   AHNRHAMSTQSLPNLKDESIPEQWPVTQAPAFPSTSRTMMPPVSPPLPGHEPVTDSGVP
FT                   MTAIRIPLEDVERPPSPPAKAFLSQPGTSAELPSAAEPSSAPAPNAEPTTLRVLVAEDD
FT                   PVNSKIVEKRLSKLGHAVILTGNGEECAAAFRRDSTKVDVVLMDIQMPIVDGTESTRMI
FT                   RQFEQEFQPPLSEKASRNGHVPVFAVSASLLEKDAQLYIEAGFDGWIMKPINFNRLGVL
FT                   LDSLENHDIRNATIYRPGYWELGGWFKHHGEL"
     MASRANASSP TRQKNDEDLS ETTSGAVGEE GAVTRAPKSG MESSTGFESE DRVYPIRSVI        60
     SVDPSTVSQS QQQAESNLSS PATGAREWSI INAETWDKMR AQTKTSAGNF SATEPPPPAP       120
     DTAGSSSEPP DQGRSHSASP TPTPDSALTK TQDPEVDSEH GLVTARFRHV VTDGGHMVIT       180
     GRANDSYQAC EDEPIHIPGA VQSFGCLLVL REEIEGKLVV RVASENSEVI LGHSPKCLFA       240
     LPNFCDILDE EQKDNLLDHL DLIRDDGFDP SVDGPEVFLL SVKLPSGKPR RFWCATHLSP       300
     ADSNSIICEF ELEDDRINPL SVSGLTTPVT PTDTLGVEPT PEQLEHSTVN ISQPLRLLRN       360
     ARRRRGEAAA MEVFSILSQI QDQLGRTKSL DSLLNTTTGL VKELTGFHRV LIYQFDTEWN       420
     GTVVAELVDP KASVDLYKGL CFPASDIPKQ ARDLYRINKV RLLYDRDQVT SRLVCRTLED       480
     LQTPVDMTHS YLRAMSPIHL KYLANMGVRA SMSISISGFN ELWGLISCHT YGTHGMRVSF       540
     PVRKICRLIG DTVSRNIERL SYASRLQARK LINTVPTDQN PSGYIIATSD DLLKLFDADY       600
     GALSIRNETK LLGKMTHSQE ILALLEYLRM QRMNSVVASH HITKDFPDLF YAPGFKHISG       660
     MLYVPLSAGG TDFMVFFRRG HLTEIKWAGN PYDKKPQNGH LEPRKSFQTW RETVLDQSRE       720
     WTESDVETAA VLCLVYGKFI KVWRQKEAAM ENSQLTRLLL ANSAHEFRTP LNAVINYLEI       780
     ALEGSLDPET RDNLTKSYSA SKSLIYVIND LLDLTNAEKG QKLIKDEIFD LPATFREATD       840
     MFEGEAKRKS IHYKVVAHPG LPPAVIGDQR RVRQVFTNLI SNAVRHTTAG SVTTEIWRSL       900
     EQAQPGCVVV QMTVLDTGSG MSQSTLEALF QELEQVSTDD DNYWFDPEDQ THPLDSCSQD       960
     KRVLGLGLAL VARIVRNMHG QLSVRSEKGK GSYFEISLNF PVPDDVASGE SEEPSVPDIV      1020
     EPAVPIQQEV EFMLVDSKST RGGEQRRRST GSDHSKGSYN SSRSGRSNRS EADRLISAMQ      1080
     DSPLLQRTTS EGSEERDPRP VERTQGSAHN RHAMSTQSLP NLKDESIPEQ WPVTQAPAFP      1140
     STSRTMMPPV SPPLPGHEPV TDSGVPMTAI RIPLEDVERP PSPPAKAFLS QPGTSAELPS      1200
     AAEPSSAPAP NAEPTTLRVL VAEDDPVNSK IVEKRLSKLG HAVILTGNGE ECAAAFRRDS      1260
     TKVDVVLMDI QMPIVDGTES TRMIRQFEQE FQPPLSEKAS RNGHVPVFAV SASLLEKDAQ      1320
     LYIEAGFDGW IMKPINFNRL GVLLDSLENH DIRNATIYRP GYWELGGWFK HHGEL           1375
//

If you have problems or comments...

PBIL Back to PBIL home page