(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE170

ASFUM1_4.PE170       Location/Qualifiers
FT   CDS             join(complement(818461..818656),complement(818004..818231),
FT                   complement(817795..817942),complement(816654..817736),
FT                   complement(814092..816591))
FT                   /codon_start=1
FT                   /gene_family="HOG000048683" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16274709"
FT                   /gene_name="dcl2"
FT                   /orf_name="AFUA_4G02930"
FT                   /product="Dicer-like protein 2 "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /function="metal ion binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /biological_process="regulation of defense response to
FT                   virus"
FT                   /biological_process="response to virus"
FT                   /protein_id="EAL84441.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0009615"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0050688"
FT                   /db_xref="HOGENOM:HBG054349"
FT                   /db_xref="HOGENOM:HBG327492"
FT                   /db_xref="HSSP:2FFL"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005034"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000051FB41"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WA22"
FT                   /transl_table=1
FT                   /translation="MASTVSTCQDASPYQPRNYQLEMLEASMKENIIVAVCSLNSYVKL
FT                   QNGNDNDPLDGYRERQNAYVFALCIQQHEVIASNLPAVRTRTLTGLDKVELWTDQSIWD
FT                   AVLNGYRVIVSTHAVLADALSHGFVKMSQLALLIFDEAHHCTRRHAANKIMQDFYHPTL
FT                   TKSGPAAVPRIMGLTASPVVRSNHQELLMVESNLDAVCRTPRLHRQELLKFTHRPHLQQ
FT                   IWYTPTDPAGFRSASLTLGALYHAWENLDIGDDPYIQRLRKSPLDDRALKKALLTGKTY
FT                   CREQLRRFVDRSRHIFEELGEWAAEYYIYASIKQLRDRVRDSYMSGDWDEAEKAYLVDF
FT                   LSKIPTSDIHFALNDPDGFRISPKFESLLNFLDSSDQREFSGLIFVKQRVTVSAMTSLL
FT                   SVHPYTRERFRCAAYVGWSNSSASKDILGDLLNMQLQRDTLDDFRSGRKNLIIATDVLE
FT                   EGIDLSACSVVVCYDKPPNLKSFIQRRGRARRKQSTFAIMFPTDDTSADVSRWQDLEQA
FT                   MIEAYQDDERQLQSVSALESLDEEVMERLTGDSTSAVLTADMAMAHLHHFCAVLPPQPY
FT                   VDMRPVFSFETNEDGLLKGTVILPSCVHPKVRRTEGRRWWRTERAAMKETAFQAYKSLY
FT                   EFGLVNDHLLPLTKKPELKTHDLGSMPSILETSEQYDPWIEWAYSWSSPDIHQSRIVVK
FT                   MNEGRGDELCMRLIGPEYLPPLSPMTLFWNSSTTFTVTFKAAERVPLVPLSSVEDMRAI
FT                   TALYLKATSSRVCSAERDFMALFAPDLHHTELKGWLDTYEGSDPAMEVYSRGHNPLLMG
FT                   VVRDHSRYGEPFLFRKWLVSHQNPSCSIVELECAPFPHRRNFLRRQTLANSQVDVDEAI
FT                   PDSAAKNPIVAAEACTIDRLPFTMAIFGLFISAIVEQLEIELIATRLRDTILRDVSFKS
FT                   TDHIITAISTPLAHRLTNYQRYEFLGDSILKFSVSCQLFFQHPNWHEGYLSEGRDMIVQ
FT                   NPRLAKAALDTGLDAYIVTKRLASRKWSAPLISEKLGRVPAKRQMSTKVLADVVEALIG
FT                   AAYVDGGHSTAQACIRRFLPEINLHAVDTRTAARSVAPESARHMMNDRLKDHIGYTFED
FT                   ESLLVEALTHPSCDYDSTTQSYQRLEYLGDAVLDMVIVSAIFNHRIQRPQGDMTKIKHA
FT                   VVNANLLAFLCMEFAISEEKLDVAQTSKDSFAVTSSQESVELWRFMRYRGQGLKAARDA
FT                   SLARHRALRDEIASSLLQAPHYPWHALSRLNADKFFSDIIESVLGAIFVDSGGNLAPCE
FT                   VFVEQIGLMAYLRRILDHGIDVRHPRSVVQQLAKTNIQFVLQRVPTEEGGASYQCSVQM
FT                   EQAELFVVTGCLTAEEAEVTAAVEAIKFLTRDEGSTPLNKS"
     MASTVSTCQD ASPYQPRNYQ LEMLEASMKE NIIVAVCSLN SYVKLQNGND NDPLDGYRER        60
     QNAYVFALCI QQHEVIASNL PAVRTRTLTG LDKVELWTDQ SIWDAVLNGY RVIVSTHAVL       120
     ADALSHGFVK MSQLALLIFD EAHHCTRRHA ANKIMQDFYH PTLTKSGPAA VPRIMGLTAS       180
     PVVRSNHQEL LMVESNLDAV CRTPRLHRQE LLKFTHRPHL QQIWYTPTDP AGFRSASLTL       240
     GALYHAWENL DIGDDPYIQR LRKSPLDDRA LKKALLTGKT YCREQLRRFV DRSRHIFEEL       300
     GEWAAEYYIY ASIKQLRDRV RDSYMSGDWD EAEKAYLVDF LSKIPTSDIH FALNDPDGFR       360
     ISPKFESLLN FLDSSDQREF SGLIFVKQRV TVSAMTSLLS VHPYTRERFR CAAYVGWSNS       420
     SASKDILGDL LNMQLQRDTL DDFRSGRKNL IIATDVLEEG IDLSACSVVV CYDKPPNLKS       480
     FIQRRGRARR KQSTFAIMFP TDDTSADVSR WQDLEQAMIE AYQDDERQLQ SVSALESLDE       540
     EVMERLTGDS TSAVLTADMA MAHLHHFCAV LPPQPYVDMR PVFSFETNED GLLKGTVILP       600
     SCVHPKVRRT EGRRWWRTER AAMKETAFQA YKSLYEFGLV NDHLLPLTKK PELKTHDLGS       660
     MPSILETSEQ YDPWIEWAYS WSSPDIHQSR IVVKMNEGRG DELCMRLIGP EYLPPLSPMT       720
     LFWNSSTTFT VTFKAAERVP LVPLSSVEDM RAITALYLKA TSSRVCSAER DFMALFAPDL       780
     HHTELKGWLD TYEGSDPAME VYSRGHNPLL MGVVRDHSRY GEPFLFRKWL VSHQNPSCSI       840
     VELECAPFPH RRNFLRRQTL ANSQVDVDEA IPDSAAKNPI VAAEACTIDR LPFTMAIFGL       900
     FISAIVEQLE IELIATRLRD TILRDVSFKS TDHIITAIST PLAHRLTNYQ RYEFLGDSIL       960
     KFSVSCQLFF QHPNWHEGYL SEGRDMIVQN PRLAKAALDT GLDAYIVTKR LASRKWSAPL      1020
     ISEKLGRVPA KRQMSTKVLA DVVEALIGAA YVDGGHSTAQ ACIRRFLPEI NLHAVDTRTA      1080
     ARSVAPESAR HMMNDRLKDH IGYTFEDESL LVEALTHPSC DYDSTTQSYQ RLEYLGDAVL      1140
     DMVIVSAIFN HRIQRPQGDM TKIKHAVVNA NLLAFLCMEF AISEEKLDVA QTSKDSFAVT      1200
     SSQESVELWR FMRYRGQGLK AARDASLARH RALRDEIASS LLQAPHYPWH ALSRLNADKF      1260
     FSDIIESVLG AIFVDSGGNL APCEVFVEQI GLMAYLRRIL DHGIDVRHPR SVVQQLAKTN      1320
     IQFVLQRVPT EEGGASYQCS VQMEQAELFV VTGCLTAEEA EVTAAVEAIK FLTRDEGSTP      1380
     LNKS                                                                   1384
//

If you have problems or comments...

PBIL Back to PBIL home page