(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE171

ASFUM1_4.PE171       Location/Qualifiers
FT   CDS             join(complement(822027..822221),complement(820177..820401),
FT                   complement(819611..820123))
FT                   /codon_start=1
FT                   /gene_family="HOG000048682" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18210318"
FT                   /gene_name="kapC"
FT                   /orf_name="AFUA_4G02940"
FT                   /product="Putative transcription factor kapC "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84442.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG054350"
FT                   /db_xref="HOGENOM:HBG327493"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI000051FD82"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WA21"
FT                   /transl_table=1
FT                   /translation="MASTPRTELVNPNPQTESINVLKRISCQPCCGCGYISKVAGAAEL
FT                   TGKWAGHTSASDAPKSNQIDQARPQPPAPQPPHMQPNTPARDQNNIDPAISGATMLTGP
FT                   PQTPTQPDVTGQETPKTYGKRPLSTSKRAAQNRAAQRAFRQRKEAHIRELEGKVKAYES
FT                   MGEAIKALQAENYQLREYIINLQSRLLDSQGEVPELPGNIDLSQPRSEIPVPPIPNSGT
FT                   ATTTAPPPTAPQQPQPSHAQAPTSNDDMNSLNRIAVAGLGMRKPPTEEANYLGNNFQAQ
FT                   ARRVRPDEGQPEASELPKQEQTHGLPLIS"
     MASTPRTELV NPNPQTESIN VLKRISCQPC CGCGYISKVA GAAELTGKWA GHTSASDAPK        60
     SNQIDQARPQ PPAPQPPHMQ PNTPARDQNN IDPAISGATM LTGPPQTPTQ PDVTGQETPK       120
     TYGKRPLSTS KRAAQNRAAQ RAFRQRKEAH IRELEGKVKA YESMGEAIKA LQAENYQLRE       180
     YIINLQSRLL DSQGEVPELP GNIDLSQPRS EIPVPPIPNS GTATTTAPPP TAPQQPQPSH       240
     AQAPTSNDDM NSLNRIAVAG LGMRKPPTEE ANYLGNNFQA QARRVRPDEG QPEASELPKQ       300
     EQTHGLPLIS                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page