(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE178

ASFUM1_4.PE178       Location/Qualifiers
FT   CDS             join(complement(840852..840907),complement(840678..840800),
FT                   complement(840488..840611))
FT                   /codon_start=1
FT                   /gene_family="HOG000169808" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274714"
FT                   /orf_name="AFUA_4G03010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84449.1"
FT                   /db_xref="HOGENOM:HBG054355"
FT                   /db_xref="InterPro:IPR021128"
FT                   /db_xref="UniParc:UPI000051EA52"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA14"
FT                   /transl_table=1
FT                   /translation="MPTALSKFVLAIDVIFSYLWLTAFIFAAQDYNEQNCYFNSPPFVG
FT                   CSKKKANEAFIFLAFFFTFAGMFLEIASLAAYRRENAPVREKNGHGAAPATAAAV"
     MPTALSKFVL AIDVIFSYLW LTAFIFAAQD YNEQNCYFNS PPFVGCSKKK ANEAFIFLAF        60
     FFTFAGMFLE IASLAAYRRE NAPVREKNGH GAAPATAAAV                             100
//

If you have problems or comments...

PBIL Back to PBIL home page