(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE179

ASFUM1_4.PE179       Location/Qualifiers
FT   CDS             join(complement(845604..845799),complement(845214..845534),
FT                   complement(844227..845167),complement(843363..844178))
FT                   /codon_start=1
FT                   /gene_family="HOG000171615" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16274715"
FT                   /orf_name="AFUA_4G03020"
FT                   /product="Chromatin remodeling complex subunit (Arp5),
FT                   putative"
FT                   /protein_id="EAL84450.1"
FT                   /db_xref="HOGENOM:HBG327501"
FT                   /db_xref="HOGENOM:HBG351854"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI000051E581"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA13"
FT                   /transl_table=1
FT                   /translation="MTITSVQTILPSRFAVTSTEKNAAKPPPKIYNVLDNPFKGYQPPQ
FT                   PDGYERSRSKPSTSAIVIDNGSSLLKAGWSFDVSPRFILPPVMSRYRDRKLNKGCQFIG
FT                   YDAYVDATTRGQLRYAFDPGTSVVGNWDVMEGLLDYVFIKLGVDGANGGVDRPIVMTEP
FT                   IANLNYPRRMMNEILFECYSAPSVAYGIDSLFSYRYNKGTDGLIISSSHTSTHVIPVLN
FT                   SKALLSNCSRLNWGGMHASEYMLKLMKLKYPTFPARMTESQMEDLVHKHCYVSTDYDRE
FT                   LSSYLEWTGLEDRDHIIQYPFTEHVVPEKTEEELARIAERKKESGRRLQEQAAKMRLEK
FT                   LMKKEQELEYWKDLQRGLASETKKEARRILDSEDLKDEAHLDRLIRDLERSIKRSRNRD
FT                   LGVEETEEPPEDMSFPLLDVPDEELDEAGLKEKRHQRLMKSNIEARQRAKAEKERERAR
FT                   KEEEERLDREKRENDFENWVAERRAARQNILQRIKERDRMKADLGNRKSLASQMRMKTL
FT                   ANLAADGPKKRRRGGDDDDFGANDEDWGVYRTVATGEQSDEEEEEDLGEMLTNIENELL
FT                   QYDPEFTENHTLAAQSDWTKSLVHVFLRGPWPFDPESQREAHQIHLNVERIRVPEVVFK
FT                   PSIAGIDQAGLLEIAAGIVNQRFSNPEDQAKLLRDVFLTGGNTLFKGFDERIRNELRSY
FT                   LPVDAQLNVRRASDPVLDAWKGAAQWASGSGLKNHSVSREEYLEKGSEYIKVRQVMYLP
FT                   GHVE"
     MTITSVQTIL PSRFAVTSTE KNAAKPPPKI YNVLDNPFKG YQPPQPDGYE RSRSKPSTSA        60
     IVIDNGSSLL KAGWSFDVSP RFILPPVMSR YRDRKLNKGC QFIGYDAYVD ATTRGQLRYA       120
     FDPGTSVVGN WDVMEGLLDY VFIKLGVDGA NGGVDRPIVM TEPIANLNYP RRMMNEILFE       180
     CYSAPSVAYG IDSLFSYRYN KGTDGLIISS SHTSTHVIPV LNSKALLSNC SRLNWGGMHA       240
     SEYMLKLMKL KYPTFPARMT ESQMEDLVHK HCYVSTDYDR ELSSYLEWTG LEDRDHIIQY       300
     PFTEHVVPEK TEEELARIAE RKKESGRRLQ EQAAKMRLEK LMKKEQELEY WKDLQRGLAS       360
     ETKKEARRIL DSEDLKDEAH LDRLIRDLER SIKRSRNRDL GVEETEEPPE DMSFPLLDVP       420
     DEELDEAGLK EKRHQRLMKS NIEARQRAKA EKERERARKE EEERLDREKR ENDFENWVAE       480
     RRAARQNILQ RIKERDRMKA DLGNRKSLAS QMRMKTLANL AADGPKKRRR GGDDDDFGAN       540
     DEDWGVYRTV ATGEQSDEEE EEDLGEMLTN IENELLQYDP EFTENHTLAA QSDWTKSLVH       600
     VFLRGPWPFD PESQREAHQI HLNVERIRVP EVVFKPSIAG IDQAGLLEIA AGIVNQRFSN       660
     PEDQAKLLRD VFLTGGNTLF KGFDERIRNE LRSYLPVDAQ LNVRRASDPV LDAWKGAAQW       720
     ASGSGLKNHS VSREEYLEKG SEYIKVRQVM YLPGHVE                                757
//

If you have problems or comments...

PBIL Back to PBIL home page