(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE180

ASFUM1_4.PE180       Location/Qualifiers
FT   CDS             847156..847713
FT                   /codon_start=1
FT                   /gene_family="HOG000039089" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274716"
FT                   /orf_name="AFUA_4G03030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84451.1"
FT                   /db_xref="HOGENOM:HBG327503"
FT                   /db_xref="HOGENOM:HBG434839"
FT                   /db_xref="InterPro:IPR013272"
FT                   /db_xref="UniParc:UPI000051EA3D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA12"
FT                   /transl_table=1
FT                   /translation="MGAPPTPAESQEHQQLLNRLDIAQVPRPFRNPNWRPSQRRNKNVK
FT                   QLISENSRKEASVMATQANSGASTPFQPSTDGSQTPVDSSARTNIAQAAQNLSTLVLEK
FT                   NARAMLPSGPAVTYTNIESAPSLHPSQHTRYCDITGLPAPYTDPKTRLRYHDKEVFGVI
FT                   RTLSQGVPESYLELRGAHVVLK"
     MGAPPTPAES QEHQQLLNRL DIAQVPRPFR NPNWRPSQRR NKNVKQLISE NSRKEASVMA        60
     TQANSGASTP FQPSTDGSQT PVDSSARTNI AQAAQNLSTL VLEKNARAML PSGPAVTYTN       120
     IESAPSLHPS QHTRYCDITG LPAPYTDPKT RLRYHDKEVF GVIRTLSQGV PESYLELRGA       180
     HVVLK                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page