(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE181

ASFUM1_4.PE181       Location/Qualifiers
FT   CDS             join(848943..848984,849099..849395)
FT                   /codon_start=1
FT                   /gene_family="HOG000035939" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274717"
FT                   /orf_name="AFUA_4G03040"
FT                   /product="Got1 family protein"
FT                   /biological_process="vesicle-mediated transport "
FT                   /protein_id="EAL84452.1"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG204028"
FT                   /db_xref="HOGENOM:HBG592905"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="UniParc:UPI000051EC6D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA11"
FT                   /transl_table=1
FT                   /translation="MYHSGLYFESLQANILFLIGLTLIIGVQRTLAFFSRRQKLKGTAA
FT                   FAAGILLILFRWPLTGFLIELYGLFILFGDFLVTIGQFAGNIPVVGPYIKTALETLAGG
FT                   RRNAELPV"
     MYHSGLYFES LQANILFLIG LTLIIGVQRT LAFFSRRQKL KGTAAFAAGI LLILFRWPLT        60
     GFLIELYGLF ILFGDFLVTI GQFAGNIPVV GPYIKTALET LAGGRRNAEL PV               112
//

If you have problems or comments...

PBIL Back to PBIL home page