(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE183

ASFUM1_4.PE183       Location/Qualifiers
FT   CDS             join(853078..853995,854051..854962)
FT                   /codon_start=1
FT                   /gene_family="HOG000171570" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753603"
FT                   /orf_name="AFUA_4G03060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84454.1"
FT                   /db_xref="HOGENOM:HBG054356"
FT                   /db_xref="HOGENOM:HBG327505"
FT                   /db_xref="UniParc:UPI000051F646"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA09"
FT                   /transl_table=1
FT                   /translation="MARGILGRSRAPEAIEIISNPGLKYSDAIPRTDLRDVKSVANNSR
FT                   PVNRAVAQWNFQRPRTADGRQPIKKGQGVNPGFDFQIAIPPAEAVPLPKSPDDDINANM
FT                   IGIALGSPRMAEPQRILPQMQEQPPVSTSASPEQVSPQTKTLKRKPSKWRKIGGLFKAK
FT                   NAFPATANQPFYQLRCAEEWPLQESTHSVDYKHQQEAAKSEPENATPQNLPNLEKWPCL
FT                   EGKDESKSCVQSSSETVPQESVKNIDLASGTKLRTAGPFLQIDIPDVQLERYSVMFGGV
FT                   LNQNTPSLLKRRSKTLEDVRIPKPDASIPPPDFQSPRRRATSPQPRLPSFNLFPTQAPV
FT                   SKASRVLGSQNIPRGPSPLHRSQTSLSGIGRQTPTNDPNHDLLVVQSPSIKSPMLHQTK
FT                   DSVSSTVSMDSTEEQRLLQKLKQTKIYVDKEQEPEWEIINKKPTSKGLSPRPSPIQNPT
FT                   PSPRQRTPPLALKINTQVLPSTTSSISSAPSPHLSPINSAARDKPERNRSPVETLSAVF
FT                   PFSATRMPLSDDTEDIEAKEAMDPIPKVEVSIARSVSVSRGKKQVIVPIRPRAGRLNPN
FT                   ERLVVRQAKTPQVRDAQHGHRHGISQDVRIETI"
     MARGILGRSR APEAIEIISN PGLKYSDAIP RTDLRDVKSV ANNSRPVNRA VAQWNFQRPR        60
     TADGRQPIKK GQGVNPGFDF QIAIPPAEAV PLPKSPDDDI NANMIGIALG SPRMAEPQRI       120
     LPQMQEQPPV STSASPEQVS PQTKTLKRKP SKWRKIGGLF KAKNAFPATA NQPFYQLRCA       180
     EEWPLQESTH SVDYKHQQEA AKSEPENATP QNLPNLEKWP CLEGKDESKS CVQSSSETVP       240
     QESVKNIDLA SGTKLRTAGP FLQIDIPDVQ LERYSVMFGG VLNQNTPSLL KRRSKTLEDV       300
     RIPKPDASIP PPDFQSPRRR ATSPQPRLPS FNLFPTQAPV SKASRVLGSQ NIPRGPSPLH       360
     RSQTSLSGIG RQTPTNDPNH DLLVVQSPSI KSPMLHQTKD SVSSTVSMDS TEEQRLLQKL       420
     KQTKIYVDKE QEPEWEIINK KPTSKGLSPR PSPIQNPTPS PRQRTPPLAL KINTQVLPST       480
     TSSISSAPSP HLSPINSAAR DKPERNRSPV ETLSAVFPFS ATRMPLSDDT EDIEAKEAMD       540
     PIPKVEVSIA RSVSVSRGKK QVIVPIRPRA GRLNPNERLV VRQAKTPQVR DAQHGHRHGI       600
     SQDVRIETI                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page