(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE185

ASFUM1_4.PE185       Location/Qualifiers
FT   CDS             complement(861833..862195)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274719"
FT                   /orf_name="AFUA_4G03080"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /protein_id="EAL84456.1"
FT                   /db_xref="HOGENOM:HBG054357"
FT                   /db_xref="UniParc:UPI000051FD71"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA07"
FT                   /transl_table=1
FT                   /translation="MSLTILDLQHQQRHQARNLQCYGCHQSFKTFSGMLIHLESGSCPS
FT                   GTDIDDINRLARQCYQSRKYIDTAGDYICPACDKFCSKLSGLFQHVEDSLGCLYLKEGG
FT                   QCLAKLEYYISWNVRR"
     MSLTILDLQH QQRHQARNLQ CYGCHQSFKT FSGMLIHLES GSCPSGTDID DINRLARQCY        60
     QSRKYIDTAG DYICPACDKF CSKLSGLFQH VEDSLGCLYL KEGGQCLAKL EYYISWNVRR       120
//

If you have problems or comments...

PBIL Back to PBIL home page