(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE188

ASFUM1_4.PE188       Location/Qualifiers
FT   CDS             join(complement(870156..870249),complement(869987..870094),
FT                   complement(869386..869926),complement(868474..869317))
FT                   /codon_start=1
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19905741"
FT                   /orf_name="AFUA_4G03110"
FT                   /product="MFS monosaccharide transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84459.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG330944"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E59C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA04"
FT                   /transl_table=1
FT                   /translation="MAPSYAGMSGRPLSLTVSTIATMGFLLFGYDQGVMSGIISDNAFA
FT                   KVFTATKDDATMQALVTAVYELGCLVGAIFALFFGDRTGRRWMIFSGAIVMIVGVIIQV
FT                   TSFVGHIPLLQFFIGRVITGIGNGMNTSTIPTYQAECSKTSNRGLLICIEGGVIAIGTA
FT                   IAYWIDFGAHYGPDDLVWRFPIAFQIFFGLIIIIGMFFLPDSPRYLISKDRIQEGEYVL
FT                   AALAGREVHDHETQIQKQSVIESIRASGSAQKTRFRDLITGGRTQHFRRMLIGSSSQIF
FT                   QQLGGCNAVIYYLPVLLKESLHQSNDMALLIGGINMIVYSLFATFSWFFIEKIGRRKLF
FT                   LGGSFLQTISMVITFACLIPGDEQTSKGAVFGLFLYMAAFGAAWLPLPWLYPAELSPIK
FT                   TRAKANAVSTCSNWLFNFTVVMITPVMVAHIGWGTYLLFAALNASFIPVIWLFYPETAN
FT                   RSLEEIDLIFTKGYVENISYVKAARELPKLIDDEIEAKAAEYAFASGDSLDEIEKAHAE
FT                   HNAAQRLETTQ"
     MAPSYAGMSG RPLSLTVSTI ATMGFLLFGY DQGVMSGIIS DNAFAKVFTA TKDDATMQAL        60
     VTAVYELGCL VGAIFALFFG DRTGRRWMIF SGAIVMIVGV IIQVTSFVGH IPLLQFFIGR       120
     VITGIGNGMN TSTIPTYQAE CSKTSNRGLL ICIEGGVIAI GTAIAYWIDF GAHYGPDDLV       180
     WRFPIAFQIF FGLIIIIGMF FLPDSPRYLI SKDRIQEGEY VLAALAGREV HDHETQIQKQ       240
     SVIESIRASG SAQKTRFRDL ITGGRTQHFR RMLIGSSSQI FQQLGGCNAV IYYLPVLLKE       300
     SLHQSNDMAL LIGGINMIVY SLFATFSWFF IEKIGRRKLF LGGSFLQTIS MVITFACLIP       360
     GDEQTSKGAV FGLFLYMAAF GAAWLPLPWL YPAELSPIKT RAKANAVSTC SNWLFNFTVV       420
     MITPVMVAHI GWGTYLLFAA LNASFIPVIW LFYPETANRS LEEIDLIFTK GYVENISYVK       480
     AARELPKLID DEIEAKAAEY AFASGDSLDE IEKAHAEHNA AQRLETTQ                    528
//

If you have problems or comments...

PBIL Back to PBIL home page