(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE19

ASFUM1_4.PE19        Location/Qualifiers
FT   CDS             79263..79988
FT                   /codon_start=1
FT                   /gene_family="HOG000200366" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210056"
FT                   /orf_name="AFUA_4G00280"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84390.2"
FT                   /db_xref="HOGENOM:HBG054300"
FT                   /db_xref="UniParc:UPI0000F51BE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W951"
FT                   /transl_table=1
FT                   /translation="MSHATDLYPSIVCCAYKEPRYSHGSQELQYLFLNQSNRDHHPHTM
FT                   HTPTPLTICTVLTALASCITTSWAQDAPAIKDSTILRSTVSCPDCPERNCYKCTLGHEK
FT                   TLRASTGGRGWERFLIGFKLPAPVTDATKCTVQFPAFVRPNPFAVNVTVARALSSDWDE
FT                   DTVNGENAPESGDIFTSMSLEPYENMQAIDITAACKGAQANGEFSIYVGTQSDSVELWS
FT                   KDSDAPAILHVSGSVCKAS"
     MSHATDLYPS IVCCAYKEPR YSHGSQELQY LFLNQSNRDH HPHTMHTPTP LTICTVLTAL        60
     ASCITTSWAQ DAPAIKDSTI LRSTVSCPDC PERNCYKCTL GHEKTLRAST GGRGWERFLI       120
     GFKLPAPVTD ATKCTVQFPA FVRPNPFAVN VTVARALSSD WDEDTVNGEN APESGDIFTS       180
     MSLEPYENMQ AIDITAACKG AQANGEFSIY VGTQSDSVEL WSKDSDAPAI LHVSGSVCKA       240
     S                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page