(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE195

ASFUM1_4.PE195       Location/Qualifiers
FT   CDS             join(887522..887636,887696..888603,888658..889011)
FT                   /codon_start=1
FT                   /gene_family="HOG000171504" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258987"
FT                   /orf_name="AFUA_4G03180"
FT                   /product="Nuclear envelope protein Brr6, putative "
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84466.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG054364"
FT                   /db_xref="HOGENOM:HBG327433"
FT                   /db_xref="InterPro:IPR018767"
FT                   /db_xref="UniParc:UPI0000520423"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Z7"
FT                   /transl_table=1
FT                   /translation="MEKRSAESPMDFEWQTRAPGDVTSPFYQLSMQHDNQKKRPHGIFD
FT                   SPQKKEIPALRAPNSQPFLFSQNPSLSSAKDPKSLFGQTAFTTPRKLDLDFSSGAENMS
FT                   SPENADNEDTPEQPARAGHRNSLFGMYGKFAPSPGRGEIPRLNHYSNALARRVQKRRRR
FT                   DKVLGLQLRRGDSDDDSDRPSSSEGKVAGKENSKQKTGQDGKSTSRLSSFSEFFALLEA
FT                   HPNVPSILSWWAQLVVNLSLFSLAVYVVFGFVSAIRAEFEQAAEEVSDTILAEMAVCAK
FT                   SYVDNKCAGGERLPALETICENWERCMNRDPAKVGRAKVSAHTMAIIINSFIDPISWKA
FT                   IMFFLATISTVTVVSNWSFRSFRNRFNQHEYAPPPPTFSRQPSGQHHPPMPSSQYSFQP
FT                   VPGLAYGDRGQEHIPNLDNKSEVPLMLEHPQMDFVTERTRDREKHMRTPSPVKRSRHFS
FT                   "
     MEKRSAESPM DFEWQTRAPG DVTSPFYQLS MQHDNQKKRP HGIFDSPQKK EIPALRAPNS        60
     QPFLFSQNPS LSSAKDPKSL FGQTAFTTPR KLDLDFSSGA ENMSSPENAD NEDTPEQPAR       120
     AGHRNSLFGM YGKFAPSPGR GEIPRLNHYS NALARRVQKR RRRDKVLGLQ LRRGDSDDDS       180
     DRPSSSEGKV AGKENSKQKT GQDGKSTSRL SSFSEFFALL EAHPNVPSIL SWWAQLVVNL       240
     SLFSLAVYVV FGFVSAIRAE FEQAAEEVSD TILAEMAVCA KSYVDNKCAG GERLPALETI       300
     CENWERCMNR DPAKVGRAKV SAHTMAIIIN SFIDPISWKA IMFFLATIST VTVVSNWSFR       360
     SFRNRFNQHE YAPPPPTFSR QPSGQHHPPM PSSQYSFQPV PGLAYGDRGQ EHIPNLDNKS       420
     EVPLMLEHPQ MDFVTERTRD REKHMRTPSP VKRSRHFS                               458
//

If you have problems or comments...

PBIL Back to PBIL home page