(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE196

ASFUM1_4.PE196       Location/Qualifiers
FT   CDS             join(889865..890159,890226..890592,890644..891017,
FT                   891087..891429,891481..891529)
FT                   /codon_start=1
FT                   /gene_family="HOG000191477" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258988"
FT                   /orf_name="AFUA_4G03190"
FT                   /product="Alpha,alpha-trehalose-phosphate synthase subunit,
FT                   putative"
FT                   /EC_number="2.4.1.15"
FT                   /function="alpha,alpha-trehalose-phosphate synthase (UDP-
FT                   forming) activity"
FT                   /biological_process="trehalose biosynthetic process "
FT                   /protein_id="EAL84467.1"
FT                   /db_xref="GO:0003825"
FT                   /db_xref="GO:0005992"
FT                   /db_xref="HOGENOM:HBG287181"
FT                   /db_xref="HOGENOM:HBG559076"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniParc:UPI0000520906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Z6"
FT                   /transl_table=1
FT                   /translation="MAPDSSQVKRNLIIVSNRLPVSVKRTDGSYKSSLSSGGLVTSLSG
FT                   LTKSTEFRWFGWPGLDVTEKKDRELVAQSLDEHNAVAVFLDANLANEHYNKFSNSILWP
FT                   ILHYQSGVVYDDGPWQAYRRVNELFADAVAEAATRGSLIWVHDYHLMLLPKLLRQRLNK
FT                   EKPCAIGFSLHTPFPAGDFWRALPVRNDLLEGMLASDLIGFHTDEYKSNFIQTCAQVLG
FT                   ARTEIPGRIQYKDRLVETDKFIVGIDPQKFKDTLQKQEVQDRIKQLEEKYKGITVIIGV
FT                   DRLDYIKGLTQKLKGYDHFLDRHPELRNKVILIQVAVPSREDVKEYQELETELSTIAGK
FT                   INGKHSTPDGVPLLYMHRSVPFTELTALYSIADACLLTSTRDGMNLVSFEYIACQEQRH
FT                   GVLVLSEFAGAASFMKEGSISFHPANTTELADAVYKAVMMGEDEKKKKYEYLRNFIETN
FT                   TSARWGETFIDRLSKHI"
     MAPDSSQVKR NLIIVSNRLP VSVKRTDGSY KSSLSSGGLV TSLSGLTKST EFRWFGWPGL        60
     DVTEKKDREL VAQSLDEHNA VAVFLDANLA NEHYNKFSNS ILWPILHYQS GVVYDDGPWQ       120
     AYRRVNELFA DAVAEAATRG SLIWVHDYHL MLLPKLLRQR LNKEKPCAIG FSLHTPFPAG       180
     DFWRALPVRN DLLEGMLASD LIGFHTDEYK SNFIQTCAQV LGARTEIPGR IQYKDRLVET       240
     DKFIVGIDPQ KFKDTLQKQE VQDRIKQLEE KYKGITVIIG VDRLDYIKGL TQKLKGYDHF       300
     LDRHPELRNK VILIQVAVPS REDVKEYQEL ETELSTIAGK INGKHSTPDG VPLLYMHRSV       360
     PFTELTALYS IADACLLTST RDGMNLVSFE YIACQEQRHG VLVLSEFAGA ASFMKEGSIS       420
     FHPANTTELA DAVYKAVMMG EDEKKKKYEY LRNFIETNTS ARWGETFIDR LSKHI            475
//

If you have problems or comments...

PBIL Back to PBIL home page