(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE20

ASFUM1_4.PE20        Location/Qualifiers
FT   CDS             join(80552..80582,80807..80881,80951..81010,81057..81153,
FT                   81209..81963,82011..82132,82187..82270)
FT                   /codon_start=1
FT                   /gene_family="HOG000007059" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273683"
FT                   /orf_name="AFUA_4G00290"
FT                   /product="Succinyl-CoA synthetase beta subunit, putative "
FT                   /EC_number="6.2.1.4"
FT                   /function="ATP binding"
FT                   /function="succinate-CoA ligase (GDP-forming) activity "
FT                   /protein_id="EAL84389.2"
FT                   /db_xref="GO:0004776"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG054299"
FT                   /db_xref="HOGENOM:HBG315432"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniParc:UPI0000F51BCF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W952"
FT                   /transl_table=1
FT                   /translation="MVIPLDYVPEGRHSLQAASTAAEPPRASFPQTSRAVPRGYVVTNP
FT                   GDAEAVVSSIGAPSVLKSQILAGGRGKGKMSSDGKGGIRIVATPEQAFQNASRMLGHYL
FT                   ATQQTPPHGLLVKKLYIYKAVDVEQEFYLALTFDRERYSPVILISDQGGVNIESNQDKL
FT                   HRFWFNLSRGITGETMAGIQKQSCFTDKEMPTIESIIRQMIKLFEERDAILLELNPLVR
FT                   TPEGSFVCLDAKFEFDNAAQFRQPEVFSKEERMPGFEDEYEAQMHGLVYIRLNGHIGNI
FT                   VNGAGLAMATNDLINLHGGKCANFLDIGGKATTETLLKAFEILSRDQQVRGIFVNIFGG
FT                   IVRCDMIAESIIQAAHTLGGFRVPVVVRLQGTNCDAAMKRLSTSELDISTETDLEKAAK
FT                   RIIGLTWS"
     MVIPLDYVPE GRHSLQAAST AAEPPRASFP QTSRAVPRGY VVTNPGDAEA VVSSIGAPSV        60
     LKSQILAGGR GKGKMSSDGK GGIRIVATPE QAFQNASRML GHYLATQQTP PHGLLVKKLY       120
     IYKAVDVEQE FYLALTFDRE RYSPVILISD QGGVNIESNQ DKLHRFWFNL SRGITGETMA       180
     GIQKQSCFTD KEMPTIESII RQMIKLFEER DAILLELNPL VRTPEGSFVC LDAKFEFDNA       240
     AQFRQPEVFS KEERMPGFED EYEAQMHGLV YIRLNGHIGN IVNGAGLAMA TNDLINLHGG       300
     KCANFLDIGG KATTETLLKA FEILSRDQQV RGIFVNIFGG IVRCDMIAES IIQAAHTLGG       360
     FRVPVVVRLQ GTNCDAAMKR LSTSELDIST ETDLEKAAKR IIGLTWS                     407
//

If you have problems or comments...

PBIL Back to PBIL home page