(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE207

ASFUM1_4.PE207       Location/Qualifiers
FT   CDS             join(937257..937464,937576..937988,938035..938545,
FT                   938595..938668)
FT                   /codon_start=1
FT                   /gene_family="HOG000171392" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206305"
FT                   /orf_name="AFUA_4G03310"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84479.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054375"
FT                   /db_xref="HOGENOM:HBG326851"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="UniParc:UPI0000520451"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Y4"
FT                   /transl_table=1
FT                   /translation="MSQMRSSPYSTHANKEKQKAPLRKKACQNCTKSKVRCGLEKPICS
FT                   RCRSKGHSCQYPPGRVAAPQIGVTAAASRSPRPRAVTSGQTRRLDLDFTDIDLTPSLNA
FT                   VDIRDRWLRPYLLPPLGRDEILKAYHLFTLQYISITLRTYPQYMVKDGGFPPIIHHTQV
FT                   NTNQMPQALANCYSLVRMWVQAAPGSETMVMSAVEAEMERLASETTSQHDYDLLCSFQA
FT                   YLVYTILMYFSPLGNVSAVTDKIMMTLMELAFRTAQNGLLCTAETTHTRPNWESWIVVS
FT                   AKRRAIYTMYLLTSVYNSDRGLPNFVADEMKGVYVPESKVLWEVTDREVWEKEYDRHLL
FT                   EWEDGMLEISELWRSTETGSTERRERIGRWVRGVDEFVPTEFRRAPSELRNRQASTLCG
FT                   ST"
     MSQMRSSPYS THANKEKQKA PLRKKACQNC TKSKVRCGLE KPICSRCRSK GHSCQYPPGR        60
     VAAPQIGVTA AASRSPRPRA VTSGQTRRLD LDFTDIDLTP SLNAVDIRDR WLRPYLLPPL       120
     GRDEILKAYH LFTLQYISIT LRTYPQYMVK DGGFPPIIHH TQVNTNQMPQ ALANCYSLVR       180
     MWVQAAPGSE TMVMSAVEAE MERLASETTS QHDYDLLCSF QAYLVYTILM YFSPLGNVSA       240
     VTDKIMMTLM ELAFRTAQNG LLCTAETTHT RPNWESWIVV SAKRRAIYTM YLLTSVYNSD       300
     RGLPNFVADE MKGVYVPESK VLWEVTDREV WEKEYDRHLL EWEDGMLEIS ELWRSTETGS       360
     TERRERIGRW VRGVDEFVPT EFRRAPSELR NRQASTLCGS T                           401
//

If you have problems or comments...

PBIL Back to PBIL home page