(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE209

ASFUM1_4.PE209       Location/Qualifiers
FT   CDS             join(complement(940513..941164),complement(940291..940412))
FT                   /codon_start=1
FT                   /gene_family="HOG000171381" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206306"
FT                   /orf_name="AFUA_4G03322"
FT                   /product="WW domain protein"
FT                   /protein_id="EBA27179.1"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI0000F51A4E"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA62"
FT                   /transl_table=1
FT                   /translation="MSYYGERDTYYGGPPQPTYGRPPYDRPPYEQQQQQQPPYNRPPYD
FT                   IPPQDSPSYNRPPYERPPYERPPPERSPSSFDPSRPRYEGPPYNSSSPAPSAQPPAIPP
FT                   PPLPLGWVQEWEPNLRRAYFVETATGRSQWETPMQDSEHARGLSGPPPESASYYASPPP
FT                   PPPPQDGGYYPPPGEYPPPEEKKKKSSGMGKIIAGGVAGVALGAAGMALWEHEKREDEE
FT                   QEELKERVERLEEEQNHSSSSSDHERAHSPDVDDW"
     MSYYGERDTY YGGPPQPTYG RPPYDRPPYE QQQQQQPPYN RPPYDIPPQD SPSYNRPPYE        60
     RPPYERPPPE RSPSSFDPSR PRYEGPPYNS SSPAPSAQPP AIPPPPLPLG WVQEWEPNLR       120
     RAYFVETATG RSQWETPMQD SEHARGLSGP PPESASYYAS PPPPPPPQDG GYYPPPGEYP       180
     PPEEKKKKSS GMGKIIAGGV AGVALGAAGM ALWEHEKRED EEQEELKERV ERLEEEQNHS       240
     SSSSDHERAH SPDVDDW                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page