(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE21

ASFUM1_4.PE21        Location/Qualifiers
FT   CDS             join(83371..83453,83510..84354,84415..86991,87037..87284)
FT                   /codon_start=1
FT                   /gene_family="HOG000200377" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210057"
FT                   /orf_name="AFUA_4G00320"
FT                   /product="Sensor histidine kinase/response regulator,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84386.2"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG054295"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI0000F51C09"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W955"
FT                   /transl_table=1
FT                   /translation="MLEISEFCTSGRNPSPEIAMAQEREFYKYCQLPQRPGLLHRPPPS
FT                   PRCEINAELLPQSSQDTTLTALAQLGALRLNARRCMISLFDRHTQYILAESTRTLSLQD
FT                   DRVYVDGDGLWLGSSVIPKPDGICHYCCEEDQLNAGPTGPNGGYTALVIPDMTKDDRCS
FT                   KRQYVVNAPHLRFYAGVPIMSRRGIAIGAFAVSDGQPRAGLDPLEIRFMTDTAAAVMNH
FT                   LEMMRSHEQNRRGANMIAGLGSFVEGATLPSSSLRRPVHPHDDEEDQESENSQNIIPQT
FT                   RRHHPTLADGRPPLKERGQHGEAAALPSGSHERPESEKQPRVSSTPNHPRQPEITLASG
FT                   TRVIISRAARVLRDSLEVEGVVFFDASVNSYATLVRNSDGRHSDVESSSSTGDANSSSD
FT                   SDNPTTGHSSTETDDSAVCDVLGYSTAQDDSEKMTGPMRESFLRSLLRHYPRGAIFNID
FT                   ENGGVSSSEGSDTASASYVSREIVYRRDEGSKVQRRWKQRKQERLSLKEENKTLIKVFP
FT                   AARSVTMFPLWDSRRNRWFSGLFVWTAAPRVFSLTGELAYLYAFSNSIMAEIHRLDIEL
FT                   ANKAHATLVGSISHELRSPLHGILGSTELLTDSTMKPAQVALVNTIEHCGRSLLDIINN
FT                   MLDFAKINQFTRKSRSSRFKSTHALRRRPGLPAGIAFKDKPGLGVVNLISDVQLDAVLE
FT                   EVVDSVFAGHCFSAKGGLVARPASQAPARDRDGHLIMKGATERPLSAFNEALTIIYDVE
FT                   PGVQWLFETQAGSWRRILMNLFGNALKYTQSGYISVTLRCSSTPSNAKMKRLARGDGTR
FT                   EGMGSVTLTVRDTGQGIDKQYLQSNVFKPFSQEDPLSPGSGLGLSIVHQTVVSLGGKVD
FT                   ITSTKGIGTEVTVTLDLPRTPQAEVAENERDASIIRKAKDRVRGKSIGLIGFESSSAEE
FT                   DEALVLLRLSLLRMYKEHFGMEVGLVPSNVSDQQVYDIYLVRQSNLDEVDQICRQVTMA
FT                   ESDSRSPPMIVICSTPQMVQKLSTTASQRPSTSIYEFISQPCGPSKMANSLLTCLKRQR
FT                   ERPSCMSAGGLDTAFLNAACASKPRRHSENVSRVDFSLMPEKAIVSVTTTNVDDSAMEV
FT                   TTIEATKRVPSVLLVDDNDVNLKLLVAFMKKAKFPYYTASNGLEALEVYKANAGYIPVV
FT                   LMDISMPVMDGLEATREIRLFEKMHREGSTNAGHSCFKPTTVIVLSGLGSAPVRQEAFN
FT                   SGIDLFLSKPIRFQELVKQIDELMH"
     MLEISEFCTS GRNPSPEIAM AQEREFYKYC QLPQRPGLLH RPPPSPRCEI NAELLPQSSQ        60
     DTTLTALAQL GALRLNARRC MISLFDRHTQ YILAESTRTL SLQDDRVYVD GDGLWLGSSV       120
     IPKPDGICHY CCEEDQLNAG PTGPNGGYTA LVIPDMTKDD RCSKRQYVVN APHLRFYAGV       180
     PIMSRRGIAI GAFAVSDGQP RAGLDPLEIR FMTDTAAAVM NHLEMMRSHE QNRRGANMIA       240
     GLGSFVEGAT LPSSSLRRPV HPHDDEEDQE SENSQNIIPQ TRRHHPTLAD GRPPLKERGQ       300
     HGEAAALPSG SHERPESEKQ PRVSSTPNHP RQPEITLASG TRVIISRAAR VLRDSLEVEG       360
     VVFFDASVNS YATLVRNSDG RHSDVESSSS TGDANSSSDS DNPTTGHSST ETDDSAVCDV       420
     LGYSTAQDDS EKMTGPMRES FLRSLLRHYP RGAIFNIDEN GGVSSSEGSD TASASYVSRE       480
     IVYRRDEGSK VQRRWKQRKQ ERLSLKEENK TLIKVFPAAR SVTMFPLWDS RRNRWFSGLF       540
     VWTAAPRVFS LTGELAYLYA FSNSIMAEIH RLDIELANKA HATLVGSISH ELRSPLHGIL       600
     GSTELLTDST MKPAQVALVN TIEHCGRSLL DIINNMLDFA KINQFTRKSR SSRFKSTHAL       660
     RRRPGLPAGI AFKDKPGLGV VNLISDVQLD AVLEEVVDSV FAGHCFSAKG GLVARPASQA       720
     PARDRDGHLI MKGATERPLS AFNEALTIIY DVEPGVQWLF ETQAGSWRRI LMNLFGNALK       780
     YTQSGYISVT LRCSSTPSNA KMKRLARGDG TREGMGSVTL TVRDTGQGID KQYLQSNVFK       840
     PFSQEDPLSP GSGLGLSIVH QTVVSLGGKV DITSTKGIGT EVTVTLDLPR TPQAEVAENE       900
     RDASIIRKAK DRVRGKSIGL IGFESSSAEE DEALVLLRLS LLRMYKEHFG MEVGLVPSNV       960
     SDQQVYDIYL VRQSNLDEVD QICRQVTMAE SDSRSPPMIV ICSTPQMVQK LSTTASQRPS      1020
     TSIYEFISQP CGPSKMANSL LTCLKRQRER PSCMSAGGLD TAFLNAACAS KPRRHSENVS      1080
     RVDFSLMPEK AIVSVTTTNV DDSAMEVTTI EATKRVPSVL LVDDNDVNLK LLVAFMKKAK      1140
     FPYYTASNGL EALEVYKANA GYIPVVLMDI SMPVMDGLEA TREIRLFEKM HREGSTNAGH      1200
     SCFKPTTVIV LSGLGSAPVR QEAFNSGIDL FLSKPIRFQE LVKQIDELMH                 1250
//

If you have problems or comments...

PBIL Back to PBIL home page